GenomeNet

Database: UniProt/SWISS-PROT
Entry: GCP6_MOUSE
LinkDB: GCP6_MOUSE
Original site: GCP6_MOUSE 
ID   GCP6_MOUSE              Reviewed;        1769 AA.
AC   G5E8P0; Q6PFC6; Q6ZPK3; Q8BWI2;
DT   11-MAY-2016, integrated into UniProtKB/Swiss-Prot.
DT   14-DEC-2011, sequence version 1.
DT   13-FEB-2019, entry version 59.
DE   RecName: Full=Gamma-tubulin complex component 6;
DE            Short=GCP-6;
GN   Name=Tubgcp6; Synonyms=Kiaa1669;
OS   Mus musculus (Mouse).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
OC   Muroidea; Muridae; Murinae; Mus; Mus.
OX   NCBI_TaxID=10090;
RN   [1]
RP   NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
RC   TISSUE=Brain;
RX   PubMed=14621295; DOI=10.1093/dnares/10.4.167;
RA   Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S.,
RA   Saga Y., Nagase T., Ohara O., Koga H.;
RT   "Prediction of the coding sequences of mouse homologues of KIAA gene:
RT   III. The complete nucleotide sequences of 500 mouse KIAA-homologous
RT   cDNAs identified by screening of terminal sequences of cDNA clones
RT   randomly sampled from size-fractionated libraries.";
RL   DNA Res. 10:167-180(2003).
RN   [2]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RC   STRAIN=C57BL/6J;
RX   PubMed=19468303; DOI=10.1371/journal.pbio.1000112;
RA   Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S.,
RA   She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W.,
RA   Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T.,
RA   Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J.,
RA   Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z.,
RA   Lindblad-Toh K., Eichler E.E., Ponting C.P.;
RT   "Lineage-specific biology revealed by a finished genome assembly of
RT   the mouse.";
RL   PLoS Biol. 7:E1000112-E1000112(2009).
RN   [3]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RL   Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases.
RN   [4]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-656 (ISOFORM 1).
RC   STRAIN=C57BL/6J; TISSUE=Lung;
RX   PubMed=16141072; DOI=10.1126/science.1112014;
RA   Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N.,
RA   Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K.,
RA   Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M.,
RA   Davis M.J., Wilming L.G., Aidinis V., Allen J.E.,
RA   Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L.,
RA   Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M.,
RA   Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R.,
RA   Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G.,
RA   di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G.,
RA   Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M.,
RA   Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E.,
RA   Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N.,
RA   Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T.,
RA   Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H.,
RA   Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K.,
RA   Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J.,
RA   Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L.,
RA   Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K.,
RA   Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P.,
RA   Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O.,
RA   Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G.,
RA   Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M.,
RA   Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C.,
RA   Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y.,
RA   Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B.,
RA   Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K.,
RA   Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A.,
RA   Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K.,
RA   Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C.,
RA   Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J.,
RA   Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y.,
RA   Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T.,
RA   Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N.,
RA   Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N.,
RA   Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S.,
RA   Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J.,
RA   Hayashizaki Y.;
RT   "The transcriptional landscape of the mammalian genome.";
RL   Science 309:1559-1563(2005).
RN   [5]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 921-1769.
RC   STRAIN=C57BL/6J; TISSUE=Embryonic brain;
RX   PubMed=15489334; DOI=10.1101/gr.2596504;
RG   The MGC Project Team;
RT   "The status, quality, and expansion of the NIH full-length cDNA
RT   project: the Mammalian Gene Collection (MGC).";
RL   Genome Res. 14:2121-2127(2004).
RN   [6]
RP   IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
RC   TISSUE=Brain;
RX   PubMed=21183079; DOI=10.1016/j.cell.2010.12.001;
RA   Huttlin E.L., Jedrychowski M.P., Elias J.E., Goswami T., Rad R.,
RA   Beausoleil S.A., Villen J., Haas W., Sowa M.E., Gygi S.P.;
RT   "A tissue-specific atlas of mouse protein phosphorylation and
RT   expression.";
RL   Cell 143:1174-1189(2010).
CC   -!- FUNCTION: Gamma-tubulin complex is necessary for microtubule
CC       nucleation at the centrosome. {ECO:0000250|UniProtKB:Q96RT7}.
CC   -!- SUBUNIT: Gamma-tubulin complex is composed of gamma-tubulin,
CC       TUBGCP2, TUBGCP3, TUBGCP4, TUBGCP5 and TUBGCP6.
CC       {ECO:0000250|UniProtKB:Q96RT7}.
CC   -!- SUBCELLULAR LOCATION: Cytoplasm, cytoskeleton, microtubule
CC       organizing center, centrosome {ECO:0000250|UniProtKB:Q96RT7}.
CC   -!- ALTERNATIVE PRODUCTS:
CC       Event=Alternative splicing; Named isoforms=2;
CC       Name=1;
CC         IsoId=G5E8P0-1; Sequence=Displayed;
CC       Name=2;
CC         IsoId=G5E8P0-2; Sequence=VSP_058269, VSP_058270;
CC         Note=No experimental confirmation available. {ECO:0000305};
CC   -!- SIMILARITY: Belongs to the TUBGCP family. {ECO:0000305}.
CC   -!- SEQUENCE CAUTION:
CC       Sequence=BAC98230.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305};
DR   EMBL; AK129420; BAC98230.1; ALT_INIT; mRNA.
DR   EMBL; AC113069; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; CH466550; EDL04376.1; -; Genomic_DNA.
DR   EMBL; AK052441; BAC34992.1; -; mRNA.
DR   EMBL; BC057626; AAH57626.1; -; mRNA.
DR   CCDS; CCDS49697.1; -. [G5E8P0-1]
DR   RefSeq; NP_001156791.1; NM_001163319.1. [G5E8P0-1]
DR   UniGene; Mm.380934; -.
DR   ProteinModelPortal; G5E8P0; -.
DR   SMR; G5E8P0; -.
DR   IntAct; G5E8P0; 9.
DR   STRING; 10090.ENSMUSP00000104977; -.
DR   iPTMnet; G5E8P0; -.
DR   PhosphoSitePlus; G5E8P0; -.
DR   jPOST; G5E8P0; -.
DR   MaxQB; G5E8P0; -.
DR   PaxDb; G5E8P0; -.
DR   PRIDE; G5E8P0; -.
DR   Ensembl; ENSMUST00000109353; ENSMUSP00000104977; ENSMUSG00000051786. [G5E8P0-1]
DR   GeneID; 328580; -.
DR   KEGG; mmu:328580; -.
DR   UCSC; uc007xfh.2; mouse. [G5E8P0-1]
DR   UCSC; uc056yzw.1; mouse.
DR   CTD; 85378; -.
DR   MGI; MGI:2146071; Tubgcp6.
DR   eggNOG; KOG2000; Eukaryota.
DR   eggNOG; ENOG410XQ5B; LUCA.
DR   GeneTree; ENSGT00940000157810; -.
DR   HOGENOM; HOG000112703; -.
DR   HOVERGEN; HBG031569; -.
DR   InParanoid; G5E8P0; -.
DR   KO; K16573; -.
DR   OMA; HASDAHI; -.
DR   OrthoDB; 110079at2759; -.
DR   TreeFam; TF106321; -.
DR   Reactome; R-MMU-380270; Recruitment of mitotic centrosome proteins and complexes.
DR   Reactome; R-MMU-380320; Recruitment of NuMA to mitotic centrosomes.
DR   PRO; PR:G5E8P0; -.
DR   Proteomes; UP000000589; Chromosome 15.
DR   Bgee; ENSMUSG00000051786; Expressed in 173 organ(s), highest expression level in cerebellum.
DR   ExpressionAtlas; G5E8P0; baseline and differential.
DR   Genevisible; Q6PFC6; MM.
DR   GO; GO:0005813; C:centrosome; ISO:MGI.
DR   GO; GO:0000923; C:equatorial microtubule organizing center; IBA:GO_Central.
DR   GO; GO:0000930; C:gamma-tubulin complex; IBA:GO_Central.
DR   GO; GO:0008274; C:gamma-tubulin ring complex; ISO:MGI.
DR   GO; GO:0008275; C:gamma-tubulin small complex; IBA:GO_Central.
DR   GO; GO:0005874; C:microtubule; IEA:UniProtKB-KW.
DR   GO; GO:0000922; C:spindle pole; IEA:InterPro.
DR   GO; GO:0043015; F:gamma-tubulin binding; IBA:GO_Central.
DR   GO; GO:0008017; F:microtubule binding; ISO:MGI.
DR   GO; GO:0031122; P:cytoplasmic microtubule organization; IBA:GO_Central.
DR   GO; GO:0051321; P:meiotic cell cycle; IBA:GO_Central.
DR   GO; GO:0007020; P:microtubule nucleation; ISO:MGI.
DR   GO; GO:0051415; P:microtubule nucleation by interphase microtubule organizing center; IBA:GO_Central.
DR   GO; GO:0000278; P:mitotic cell cycle; IBA:GO_Central.
DR   GO; GO:0051225; P:spindle assembly; IBA:GO_Central.
DR   InterPro; IPR007259; GCP.
DR   InterPro; IPR040457; GCP_C.
DR   PANTHER; PTHR19302; PTHR19302; 1.
DR   Pfam; PF04130; GCP_C_terminal; 1.
PE   1: Evidence at protein level;
KW   Alternative splicing; Complete proteome; Cytoplasm; Cytoskeleton;
KW   Microtubule; Reference proteome.
FT   CHAIN         1   1769       Gamma-tubulin complex component 6.
FT                                /FTId=PRO_0000436164.
FT   VAR_SEQ     249    281       PQIVDQWEDEGFQSASNLTPDSQSEPSMTPDLD -> VFLS
FT                                LSVTLEVWKILLPGTVGKLLSKPQVSRQS (in isoform
FT                                2).
FT                                /FTId=VSP_058269.
FT   VAR_SEQ     282   1769       Missing (in isoform 2).
FT                                /FTId=VSP_058270.
SQ   SEQUENCE   1769 AA;  197192 MW;  556E139E9CAE51EE CRC64;
     MASITQLFDD LCEALLPAAQ ARPGQRSVNR KRAKRSLKRV AYNALFANLF QEDTHQRQPD
     SSKLPVKNKV LMLSFDLRVG GLGPEADRLE ELVEKLEAAP DCPFVEVASV LDLLVQLAGS
     GPPQVLRRKR DYFFNNKHAG RNIPYSGYDC YDLSVFEMDV RSFISGEENL CHHTVQEALQ
     VMEAAPGTGL PTVGLFSIGD SCGDRFERDT RVSLFGALVH SRTYDMDVRL DLPPVPDSAD
     FSGLAIKVPQ IVDQWEDEGF QSASNLTPDS QSEPSMTPDL DLWEAVLTYE ASKRRCWERI
     GCPPGHREEP YLTEAGRDAF DRFCRLRHGE LQALSGGLLQ APKPVLVEES ELVKDSLNVL
     LGVVSATFSL CRPTQAFVVE PGVHVSGASP ESISSILSEV AEYGTCYTRL SHFSLQPVVG
     SLCSRGLVFQ AFTSGLRRYL QYYRACVLST PPTLSLLTIG FLFKKLGRQL RYLAELCGVG
     TVSLATSGEP RAVFPTGVKL LSYLYQEALD NCSNEHYPVL LSLLKTSCEP YTRFIHDWVY
     SGVFRDVYGE FMIQVNHEYL SFRDKFYWTH GYVLISKEVE DCVPVFLKHI AHDVYVCGKT
     INLLKLCCPR HYLCWSDVPV PRISVIFSLE ELKEIEKDCA VYVGRMERVA RHSCISKEEK
     ELRMEIAKQE LIVHAREAAS RVLSELSDRQ MAEQIAQDTR KREQFQRLKE QFVKDQERRL
     AARQEELDDD FSYARELRDR EKRLKALEEE LERKARQALV DHYSKLSAEA ARREQKALWR
     IQRHRLESAR LRFLLEDQKC IQEMLRDMEA QQPQEPPSVF PSTGSQVTST GPEHAGEGHS
     CDPGFTELHW GCPSLPCAST PSVPKSATEG ADDSGAGPFS TGLSITDFLP VDSGEEQPVE
     NTGVPFLEVA LQTICSDLSP VAPEPAALTA GGPQATQSEY DFNTILRPAM ATSLSPGPFQ
     DVQNSVDSDK QHLLGDMSTK VDSYIHDMQE TLPCPHPLSH ATPVEGSLQP VGQLLEHMSE
     TTVSTESHAS GMAPCQQLSI SRHVSDANIK VGDYMSDVAL PRPRWNVHGH VSEASIGVGE
     NMAEVAPSRP RWNVHGHVSD ASIKIGENMS DVAPSRTRWN IHGHVSDASI KVGENVSDVT
     PSRPRWNVHG HVSEASIKVG ENVSDVTPSR PRWNVHGHVS EASIKVGENV SDVTPSRPRW
     NVHGHVSDAS IRIGENVSDT DLDLQQRGCA QPPLILEEPL PEAEADLKPH QCPPAHVSEA
     VLGVEAQSPA LECGPQLPEK TKPTVCSGFG RTEEGSLQTK TLVAEPSMLG SGIPEEKGPG
     KSRDAEDLSP CLPSSSQEDT AVPSSPGPSD EVSNTEAEAR RWGKEQAYLT DLTKLYHLEQ
     YPDSYDSMSE PPVAHLVHHM LPRAFAFPVD PQVQSAVDES AVQLSELLTL PVLMKRSLMA
     PLAAHVSLVS KAAVDYFFVE LHLETHFEAL RHFLLMEDGE FAQSLSDLLF EKLGAGQTPG
     ELLNPLVLNS ILSKALQYSL HGDTPHASNL SFALKYLPEV FAPNAPDVLS CLELRYKVDW
     PLNIVITESC LNKYSGIFSF LLQLKLMMWT LKDICFHLKR TALVSHTAGS VQFRQLQLFK
     HEMQHFVKVI QGYIANQILH VSWCEFRARL AVVGDLEEIQ RAHAEYLHRA VFRGLLTEKA
     APVMNIIHSI FSLVLKFRSQ LISQNWGPAT GPRGAEHPNF PLMQQSYSTF KYYSHFLFKV
     VTKLVNRGYQ PHLEDFLLRI NFNNYYQDS
//
DBGET integrated database retrieval system