GenomeNet

Database: UniProt/SWISS-PROT
Entry: KARG_DROME
LinkDB: KARG_DROME
Original site: KARG_DROME 
ID   KARG_DROME              Reviewed;         356 AA.
AC   P48610; Q8IQB9; Q8IQC0; Q8T0S2; Q9VST5; Q9VST6;
DT   01-FEB-1996, integrated into UniProtKB/Swiss-Prot.
DT   24-MAY-2005, sequence version 2.
DT   23-MAY-2018, entry version 134.
DE   RecName: Full=Arginine kinase;
DE            Short=AK;
DE            EC=2.7.3.3;
GN   Name=Argk; ORFNames=CG32031;
OS   Drosophila melanogaster (Fruit fly).
OC   Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
OC   Pterygota; Neoptera; Holometabola; Diptera; Brachycera; Muscomorpha;
OC   Ephydroidea; Drosophilidae; Drosophila; Sophophora.
OX   NCBI_TaxID=7227;
RN   [1]
RP   NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM D).
RA   Hecht L.B., Scott L.M., Collier G.E.;
RL   Submitted (MAY-1995) to the EMBL/GenBank/DDBJ databases.
RN   [2]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RC   STRAIN=Berkeley;
RX   PubMed=10731132; DOI=10.1126/science.287.5461.2185;
RA   Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D.,
RA   Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F.,
RA   George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N.,
RA   Sutton G.G., Wortman J.R., Yandell M.D., Zhang Q., Chen L.X.,
RA   Brandon R.C., Rogers Y.-H.C., Blazej R.G., Champe M., Pfeiffer B.D.,
RA   Wan K.H., Doyle C., Baxter E.G., Helt G., Nelson C.R., Miklos G.L.G.,
RA   Abril J.F., Agbayani A., An H.-J., Andrews-Pfannkoch C., Baldwin D.,
RA   Ballew R.M., Basu A., Baxendale J., Bayraktaroglu L., Beasley E.M.,
RA   Beeson K.Y., Benos P.V., Berman B.P., Bhandari D., Bolshakov S.,
RA   Borkova D., Botchan M.R., Bouck J., Brokstein P., Brottier P.,
RA   Burtis K.C., Busam D.A., Butler H., Cadieu E., Center A., Chandra I.,
RA   Cherry J.M., Cawley S., Dahlke C., Davenport L.B., Davies P.,
RA   de Pablos B., Delcher A., Deng Z., Mays A.D., Dew I., Dietz S.M.,
RA   Dodson K., Doup L.E., Downes M., Dugan-Rocha S., Dunkov B.C., Dunn P.,
RA   Durbin K.J., Evangelista C.C., Ferraz C., Ferriera S., Fleischmann W.,
RA   Fosler C., Gabrielian A.E., Garg N.S., Gelbart W.M., Glasser K.,
RA   Glodek A., Gong F., Gorrell J.H., Gu Z., Guan P., Harris M.,
RA   Harris N.L., Harvey D.A., Heiman T.J., Hernandez J.R., Houck J.,
RA   Hostin D., Houston K.A., Howland T.J., Wei M.-H., Ibegwam C.,
RA   Jalali M., Kalush F., Karpen G.H., Ke Z., Kennison J.A., Ketchum K.A.,
RA   Kimmel B.E., Kodira C.D., Kraft C.L., Kravitz S., Kulp D., Lai Z.,
RA   Lasko P., Lei Y., Levitsky A.A., Li J.H., Li Z., Liang Y., Lin X.,
RA   Liu X., Mattei B., McIntosh T.C., McLeod M.P., McPherson D.,
RA   Merkulov G., Milshina N.V., Mobarry C., Morris J., Moshrefi A.,
RA   Mount S.M., Moy M., Murphy B., Murphy L., Muzny D.M., Nelson D.L.,
RA   Nelson D.R., Nelson K.A., Nixon K., Nusskern D.R., Pacleb J.M.,
RA   Palazzolo M., Pittman G.S., Pan S., Pollard J., Puri V., Reese M.G.,
RA   Reinert K., Remington K., Saunders R.D.C., Scheeler F., Shen H.,
RA   Shue B.C., Siden-Kiamos I., Simpson M., Skupski M.P., Smith T.J.,
RA   Spier E., Spradling A.C., Stapleton M., Strong R., Sun E.,
RA   Svirskas R., Tector C., Turner R., Venter E., Wang A.H., Wang X.,
RA   Wang Z.-Y., Wassarman D.A., Weinstock G.M., Weissenbach J.,
RA   Williams S.M., Woodage T., Worley K.C., Wu D., Yang S., Yao Q.A.,
RA   Ye J., Yeh R.-F., Zaveri J.S., Zhan M., Zhang G., Zhao Q., Zheng L.,
RA   Zheng X.H., Zhong F.N., Zhong W., Zhou X., Zhu S.C., Zhu X.,
RA   Smith H.O., Gibbs R.A., Myers E.W., Rubin G.M., Venter J.C.;
RT   "The genome sequence of Drosophila melanogaster.";
RL   Science 287:2185-2195(2000).
RN   [3]
RP   GENOME REANNOTATION.
RC   STRAIN=Berkeley;
RX   PubMed=12537572; DOI=10.1186/gb-2002-3-12-research0083;
RA   Misra S., Crosby M.A., Mungall C.J., Matthews B.B., Campbell K.S.,
RA   Hradecky P., Huang Y., Kaminker J.S., Millburn G.H., Prochnik S.E.,
RA   Smith C.D., Tupy J.L., Whitfield E.J., Bayraktaroglu L., Berman B.P.,
RA   Bettencourt B.R., Celniker S.E., de Grey A.D.N.J., Drysdale R.A.,
RA   Harris N.L., Richter J., Russo S., Schroeder A.J., Shu S.Q.,
RA   Stapleton M., Yamada C., Ashburner M., Gelbart W.M., Rubin G.M.,
RA   Lewis S.E.;
RT   "Annotation of the Drosophila melanogaster euchromatic genome: a
RT   systematic review.";
RL   Genome Biol. 3:RESEARCH0083.1-RESEARCH0083.22(2002).
RN   [4]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A).
RC   STRAIN=Berkeley; TISSUE=Head;
RX   PubMed=12537569; DOI=10.1186/gb-2002-3-12-research0080;
RA   Stapleton M., Carlson J.W., Brokstein P., Yu C., Champe M.,
RA   George R.A., Guarin H., Kronmiller B., Pacleb J.M., Park S., Wan K.H.,
RA   Rubin G.M., Celniker S.E.;
RT   "A Drosophila full-length cDNA resource.";
RL   Genome Biol. 3:RESEARCH0080.1-RESEARCH0080.8(2002).
CC   -!- CATALYTIC ACTIVITY: ATP + L-arginine = ADP + N(omega)-phospho-L-
CC       arginine.
CC   -!- ALTERNATIVE PRODUCTS:
CC       Event=Alternative splicing; Named isoforms=4;
CC       Name=D;
CC         IsoId=P48610-1; Sequence=Displayed;
CC       Name=A;
CC         IsoId=P48610-2; Sequence=VSP_013807;
CC         Note=No experimental confirmation available.;
CC       Name=B;
CC         IsoId=P48610-3; Sequence=VSP_013808;
CC         Note=No experimental confirmation available.;
CC       Name=C;
CC         IsoId=P48610-4; Sequence=VSP_013809;
CC         Note=No experimental confirmation available.;
CC   -!- SIMILARITY: Belongs to the ATP:guanido phosphotransferase family.
CC       {ECO:0000255|PROSITE-ProRule:PRU00842, ECO:0000255|PROSITE-
CC       ProRule:PRU00843}.
DR   EMBL; U26939; AAA68172.1; -; Genomic_DNA.
DR   EMBL; U26940; AAA68173.1; -; mRNA.
DR   EMBL; AE014296; AAF50325.2; -; Genomic_DNA.
DR   EMBL; AE014296; AAF50326.2; -; Genomic_DNA.
DR   EMBL; AE014296; AAN11982.1; -; Genomic_DNA.
DR   EMBL; AE014296; AAN11983.1; -; Genomic_DNA.
DR   EMBL; AY069099; AAL39244.1; -; mRNA.
DR   RefSeq; NP_001097556.2; NM_001104086.2. [P48610-1]
DR   RefSeq; NP_001286989.1; NM_001300060.1. [P48610-1]
DR   RefSeq; NP_523988.2; NM_079264.3. [P48610-1]
DR   RefSeq; NP_729446.1; NM_168311.3. [P48610-2]
DR   RefSeq; NP_729447.1; NM_168312.3. [P48610-3]
DR   RefSeq; NP_729448.1; NM_168313.4. [P48610-4]
DR   UniGene; Dm.902; -.
DR   ProteinModelPortal; P48610; -.
DR   SMR; P48610; -.
DR   BioGrid; 64445; 60.
DR   IntAct; P48610; 16.
DR   STRING; 7227.FBpp0076270; -.
DR   PaxDb; P48610; -.
DR   PRIDE; P48610; -.
DR   EnsemblMetazoa; FBtr0076543; FBpp0076270; FBgn0000116. [P48610-2]
DR   EnsemblMetazoa; FBtr0076544; FBpp0076271; FBgn0000116. [P48610-3]
DR   EnsemblMetazoa; FBtr0076545; FBpp0076272; FBgn0000116. [P48610-1]
DR   EnsemblMetazoa; FBtr0076546; FBpp0076273; FBgn0000116. [P48610-4]
DR   EnsemblMetazoa; FBtr0331550; FBpp0303940; FBgn0000116. [P48610-1]
DR   EnsemblMetazoa; FBtr0345030; FBpp0311280; FBgn0000116. [P48610-1]
DR   GeneID; 39041; -.
DR   KEGG; dme:Dmel_CG32031; -.
DR   CTD; 39041; -.
DR   FlyBase; FBgn0000116; Argk.
DR   eggNOG; KOG3581; Eukaryota.
DR   eggNOG; COG3869; LUCA.
DR   GeneTree; ENSGT00550000074561; -.
DR   InParanoid; P48610; -.
DR   KO; K00934; -.
DR   OrthoDB; EOG091G0HZ0; -.
DR   PhylomeDB; P48610; -.
DR   Reactome; R-DME-71288; Creatine metabolism.
DR   ChiTaRS; Argk; fly.
DR   GenomeRNAi; 39041; -.
DR   PRO; PR:P48610; -.
DR   Proteomes; UP000000803; Chromosome 3L.
DR   Bgee; FBgn0000116; -.
DR   ExpressionAtlas; P48610; baseline and differential.
DR   Genevisible; P48610; DM.
DR   GO; GO:0005737; C:cytoplasm; HDA:FlyBase.
DR   GO; GO:0005829; C:cytosol; HDA:FlyBase.
DR   GO; GO:0005576; C:extracellular region; HDA:FlyBase.
DR   GO; GO:0005886; C:plasma membrane; HDA:FlyBase.
DR   GO; GO:0004054; F:arginine kinase activity; ISS:UniProtKB.
DR   GO; GO:0005524; F:ATP binding; IEA:UniProtKB-KW.
DR   GO; GO:0016310; P:phosphorylation; ISS:UniProtKB.
DR   Gene3D; 1.10.135.10; -; 1.
DR   InterPro; IPR000749; ATP-guanido_PTrfase.
DR   InterPro; IPR022415; ATP-guanido_PTrfase_AS.
DR   InterPro; IPR022414; ATP-guanido_PTrfase_cat.
DR   InterPro; IPR022413; ATP-guanido_PTrfase_N.
DR   InterPro; IPR036802; ATP-guanido_PTrfase_N_sf.
DR   InterPro; IPR014746; Gln_synth/guanido_kin_cat_dom.
DR   PANTHER; PTHR11547; PTHR11547; 1.
DR   Pfam; PF00217; ATP-gua_Ptrans; 1.
DR   Pfam; PF02807; ATP-gua_PtransN; 1.
DR   SUPFAM; SSF48034; SSF48034; 1.
DR   SUPFAM; SSF55931; SSF55931; 1.
DR   PROSITE; PS00112; PHOSPHAGEN_KINASE; 1.
DR   PROSITE; PS51510; PHOSPHAGEN_KINASE_C; 1.
DR   PROSITE; PS51509; PHOSPHAGEN_KINASE_N; 1.
PE   2: Evidence at transcript level;
KW   Alternative splicing; ATP-binding; Complete proteome; Kinase;
KW   Nucleotide-binding; Reference proteome; Transferase.
FT   CHAIN         1    356       Arginine kinase.
FT                                /FTId=PRO_0000211992.
FT   DOMAIN        6     91       Phosphagen kinase N-terminal.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00842}.
FT   DOMAIN      119    356       Phosphagen kinase C-terminal.
FT                                {ECO:0000255|PROSITE-ProRule:PRU00843}.
FT   NP_BIND     122    126       ATP. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00843}.
FT   NP_BIND     280    284       ATP. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00843}.
FT   NP_BIND     309    314       ATP. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00843}.
FT   REGION       64     68       Substrate binding. {ECO:0000250}.
FT   BINDING     185    185       ATP. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00843}.
FT   BINDING     225    225       Substrate. {ECO:0000250}.
FT   BINDING     229    229       ATP. {ECO:0000255|PROSITE-
FT                                ProRule:PRU00843}.
FT   BINDING     271    271       Substrate. {ECO:0000250}.
FT   BINDING     314    314       Substrate. {ECO:0000250}.
FT   VAR_SEQ       1      1       M -> MFALWYLTFAVDEIRKRLAWLFSSNKPAAPALDNKP
FT                                ANPAPAKESAPAPAPAPTPKPAVVPPAPKPDPPKPAPAVAK
FT                                PTPVPVPATAPAPPKEEPAPKPKPEPVPSPVVAPPKPTPPP
FT                                AKPSSPPKQADKMPIPLPKSLTEANTNGQNGNAANGGNVDE
FT                                LVFGGQQAEKVLPAAKEASNDFIKGETNAFIQSIKEAQQLG
FT                                ERKQDTM (in isoform A).
FT                                {ECO:0000303|PubMed:12537569}.
FT                                /FTId=VSP_013807.
FT   VAR_SEQ       1      1       M -> MPIPLPKSLTEANTNGQNGNAANGGNVDELVFGGQQ
FT                                AEKVLPAAKEASNDFIKGETNAFIQSIKEAQQLGERKQDTM
FT                                (in isoform B). {ECO:0000305}.
FT                                /FTId=VSP_013808.
FT   VAR_SEQ       1      1       M -> MGLCASKDKKEKVIEGEVANGEPNGTATAAGAGGDG
FT                                KQDTM (in isoform C). {ECO:0000305}.
FT                                /FTId=VSP_013809.
FT   CONFLICT      1     90       Missing (in Ref. 1; AAA68173).
FT                                {ECO:0000305}.
FT   CONFLICT     42     51       VTPTFKSTLL -> GHAHLQVDPA (in Ref. 1;
FT                                AAA68172). {ECO:0000305}.
FT   CONFLICT     64     66       GVG -> ASA (in Ref. 1; AAA68172).
FT                                {ECO:0000305}.
FT   CONFLICT     85     85       I -> F (in Ref. 1; AAA68172).
FT                                {ECO:0000305}.
FT   CONFLICT    280    280       R -> L (in Ref. 1; AAA68172).
FT                                {ECO:0000305}.
FT   CONFLICT    291    291       A -> P (in Ref. 1; AAA68172).
FT                                {ECO:0000305}.
FT   CONFLICT    309    313       RGTRG -> ANPR (in Ref. 1; AAA68172).
FT                                {ECO:0000305}.
FT   CONFLICT    322    322       V -> S (in Ref. 1; AAA68172).
FT                                {ECO:0000305}.
SQ   SEQUENCE   356 AA;  39866 MW;  9AD0E80D2CE4F446 CRC64;
     MVDAAVLAKL EEGYAKLAAS DSKSLLKKYL TKEVFDNLKN KVTPTFKSTL LDVIQSGLEN
     HDSGVGIYAP DAEAYTVFAD LFDPIIEDYH GGFKKTDKHP ASNFGDVSTF GNVDPTNEYV
     ISTRVRCGRS MQGYPFNPCL TEAQYKEMES KVSSTLSGLE GELKGKFYPL TGMEKAVQQQ
     LIDDHFLFKE GDRFLQAANA CRFWPSGRGI YHNDAKTFLV WCNEEDHLRI ISMQQGGDLG
     QIYKRLVTAV NEIEKRVPFS HDDRLGFLTF CPTNLGTTIR ASVHIKVPKL ASNKAKLEEV
     AAKYNLQVRG TRGEHTEAEG GVYDISNKRR MGLTEFEAVK EMYDGITELI KLEKSL
//
DBGET integrated database retrieval system