GenomeNet

Database: UniProt/SWISS-PROT
Entry: TMM25_HUMAN
LinkDB: TMM25_HUMAN
Original site: TMM25_HUMAN 
ID   TMM25_HUMAN             Reviewed;         366 AA.
AC   Q86YD3; A8K8J4; B0YJA6; B0YJA7; B0YJA9; G5E9U4; Q6UW89; Q86UA7; Q8NBL5;
AC   Q96KA6; Q96MW9;
DT   01-MAR-2005, integrated into UniProtKB/Swiss-Prot.
DT   01-JUN-2003, sequence version 1.
DT   17-JUN-2020, entry version 139.
DE   RecName: Full=Transmembrane protein 25;
DE   Flags: Precursor;
GN   Name=TMEM25; ORFNames=UNQ2531/PRO6030;
OS   Homo sapiens (Human).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
OX   NCBI_TaxID=9606;
RN   [1]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
RX   PubMed=12975309; DOI=10.1101/gr.1293003;
RA   Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J.,
RA   Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P.,
RA   Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E., Heldens S., Huang A.,
RA   Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D.,
RA   Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L.,
RA   Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C.,
RA   Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J.,
RA   Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.;
RT   "The secreted protein discovery initiative (SPDI), a large-scale effort to
RT   identify novel human secreted and transmembrane proteins: a bioinformatics
RT   assessment.";
RL   Genome Res. 13:2265-2270(2003).
RN   [2]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 4 AND 2).
RC   TISSUE=Embryo, and Testis;
RX   PubMed=14702039; DOI=10.1038/ng1285;
RA   Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
RA   Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
RA   Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
RA   Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
RA   Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H.,
RA   Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M.,
RA   Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K.,
RA   Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T.,
RA   Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M.,
RA   Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S.,
RA   Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H.,
RA   Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K.,
RA   Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N.,
RA   Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
RA   Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
RA   Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
RA   Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
RA   Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y.,
RA   Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K.,
RA   Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T.,
RA   Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T.,
RA   Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y.,
RA   Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H.,
RA   Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y.,
RA   Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H.,
RA   Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O.,
RA   Isogai T., Sugano S.;
RT   "Complete sequencing and characterization of 21,243 full-length human
RT   cDNAs.";
RL   Nat. Genet. 36:40-45(2004).
RN   [3]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5), AND VARIANT ARG-342.
RC   TISSUE=Placenta;
RX   PubMed=16303743; DOI=10.1093/dnares/12.2.117;
RA   Otsuki T., Ota T., Nishikawa T., Hayashi K., Suzuki Y., Yamamoto J.,
RA   Wakamatsu A., Kimura K., Sakamoto K., Hatano N., Kawai Y., Ishii S.,
RA   Saito K., Kojima S., Sugiyama T., Ono T., Okano K., Yoshikawa Y.,
RA   Aotsuka S., Sasaki N., Hattori A., Okumura K., Nagai K., Sugano S.,
RA   Isogai T.;
RT   "Signal sequence and keyword trap in silico for selection of full-length
RT   human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA
RT   libraries.";
RL   DNA Res. 12:117-126(2005).
RN   [4]
RP   NUCLEOTIDE SEQUENCE [GENOMIC DNA].
RG   NHLBI resequencing and genotyping service (RS&G);
RL   Submitted (FEB-2007) to the EMBL/GenBank/DDBJ databases.
RN   [5]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RX   PubMed=16554811; DOI=10.1038/nature04632;
RA   Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K.,
RA   Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T.,
RA   Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G.,
RA   Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C.,
RA   Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A.,
RA   Hattori M., Rogers J., Lander E.S., Sakaki Y.;
RT   "Human chromosome 11 DNA sequence and analysis including novel gene
RT   identification.";
RL   Nature 440:497-500(2006).
RN   [6]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RA   Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M.,
RA   Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J.,
RA   Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S.,
RA   Turner R., Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H.,
RA   Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K.,
RA   Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D.,
RA   Hunkapiller M.W., Myers E.W., Venter J.C.;
RL   Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
RN   [7]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), AND VARIANT
RP   ARG-342.
RC   TISSUE=Brain, and Ovary;
RX   PubMed=15489334; DOI=10.1101/gr.2596504;
RG   The MGC Project Team;
RT   "The status, quality, and expansion of the NIH full-length cDNA project:
RT   the Mammalian Gene Collection (MGC).";
RL   Genome Res. 14:2121-2127(2004).
RN   [8]
RP   PROTEIN SEQUENCE OF 27-41.
RX   PubMed=15340161; DOI=10.1110/ps.04682504;
RA   Zhang Z., Henzel W.J.;
RT   "Signal peptide prediction based on analysis of experimentally verified
RT   cleavage sites.";
RL   Protein Sci. 13:2819-2824(2004).
RN   [9]
RP   FUNCTION, AND TISSUE SPECIFICITY.
RX   PubMed=31424425; DOI=10.1172/jci122599;
RA   Zhang H., Tian X., Lu X., Xu D., Guo Y., Dong Z., Li Y., Ma Y., Chen C.,
RA   Yang Y., Yang M., Yang Y., Liu F., Zhou R., He M., Xiao F., Wang X.;
RT   "TMEM25 modulates neuronal excitability and NMDA receptor subunit NR2B
RT   degradation.";
RL   J. Clin. Invest. 129:3864-3876(2019).
CC   -!- FUNCTION: In neurons, modulates the degradation of NMDA receptor GRIN2B
CC       subunit. Plays a role in the regulation of neuronal excitability.
CC       {ECO:0000269|PubMed:31424425}.
CC   -!- SUBUNIT: Interacts with GRIN2B. {ECO:0000250|UniProtKB:Q9DCF1}.
CC   -!- INTERACTION:
CC       Q86YD3; O76003: GLRX3; NbExp=4; IntAct=EBI-10260688, EBI-374781;
CC       Q86YD3; P53611: RABGGTB; NbExp=3; IntAct=EBI-10260688, EBI-536715;
CC   -!- SUBCELLULAR LOCATION: [Isoform 1]: Cell membrane {ECO:0000305}; Single-
CC       pass type I membrane protein {ECO:0000305}.
CC   -!- SUBCELLULAR LOCATION: [Isoform 4]: Cell membrane {ECO:0000305}; Single-
CC       pass type I membrane protein {ECO:0000305}.
CC   -!- SUBCELLULAR LOCATION: [Isoform 2]: Secreted {ECO:0000305}.
CC   -!- SUBCELLULAR LOCATION: [Isoform 3]: Secreted {ECO:0000305}.
CC   -!- SUBCELLULAR LOCATION: Late endosome {ECO:0000250|UniProtKB:Q9DCF1}.
CC       Lysosome {ECO:0000250|UniProtKB:Q9DCF1}.
CC   -!- ALTERNATIVE PRODUCTS:
CC       Event=Alternative splicing; Named isoforms=5;
CC       Name=1;
CC         IsoId=Q86YD3-1; Sequence=Displayed;
CC       Name=2;
CC         IsoId=Q86YD3-2; Sequence=VSP_012940;
CC       Name=3;
CC         IsoId=Q86YD3-3; Sequence=VSP_012939, VSP_012940;
CC       Name=4;
CC         IsoId=Q86YD3-4; Sequence=VSP_012941;
CC       Name=5;
CC         IsoId=Q86YD3-5; Sequence=VSP_012940, VSP_045635, VSP_012941;
CC   -!- TISSUE SPECIFICITY: Expressed throughout the brain with higher levels
CC       in the pyramidal cell layer of the hippocampal CA1 and CA3 regions.
CC       Also highly expressed iwhith the hippocampal dentate gyrus region and
CC       cerebellum and in scattered neurons in the cerebral cortex.
CC       {ECO:0000269|PubMed:16303743}.
DR   EMBL; AY358919; AAQ89278.1; -; mRNA.
DR   EMBL; AK027305; BAB55029.1; -; mRNA.
DR   EMBL; AK056325; BAB71151.1; -; mRNA.
DR   EMBL; AK292359; BAF85048.1; -; mRNA.
DR   EMBL; AK075437; BAC11620.1; -; mRNA.
DR   EMBL; EF445037; ACA06084.1; -; Genomic_DNA.
DR   EMBL; EF445037; ACA06085.1; -; Genomic_DNA.
DR   EMBL; EF445037; ACA06086.1; -; Genomic_DNA.
DR   EMBL; EF445037; ACA06087.1; -; Genomic_DNA.
DR   EMBL; AP000941; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; CH471065; EAW67388.1; -; Genomic_DNA.
DR   EMBL; CH471065; EAW67389.1; -; Genomic_DNA.
DR   EMBL; CH471065; EAW67393.1; -; Genomic_DNA.
DR   EMBL; BC042896; AAH42896.1; -; mRNA.
DR   EMBL; BC051841; AAH51841.1; -; mRNA.
DR   CCDS; CCDS44745.1; -. [Q86YD3-4]
DR   CCDS; CCDS44746.1; -. [Q86YD3-5]
DR   CCDS; CCDS44747.1; -. [Q86YD3-2]
DR   CCDS; CCDS44748.1; -. [Q86YD3-3]
DR   CCDS; CCDS8398.1; -. [Q86YD3-1]
DR   RefSeq; NP_001137506.1; NM_001144034.1. [Q86YD3-2]
DR   RefSeq; NP_001137507.1; NM_001144035.1. [Q86YD3-2]
DR   RefSeq; NP_001137508.1; NM_001144036.1. [Q86YD3-3]
DR   RefSeq; NP_001137509.1; NM_001144037.1. [Q86YD3-4]
DR   RefSeq; NP_001137510.1; NM_001144038.1. [Q86YD3-5]
DR   RefSeq; NP_001305684.1; NM_001318755.1.
DR   RefSeq; NP_001305686.1; NM_001318757.1.
DR   RefSeq; NP_116169.2; NM_032780.3. [Q86YD3-1]
DR   RefSeq; XP_016873911.1; XM_017018422.1. [Q86YD3-1]
DR   BioGRID; 124311; 89.
DR   IntAct; Q86YD3; 60.
DR   MINT; Q86YD3; -.
DR   STRING; 9606.ENSP00000315635; -.
DR   iPTMnet; Q86YD3; -.
DR   PhosphoSitePlus; Q86YD3; -.
DR   BioMuta; TMEM25; -.
DR   jPOST; Q86YD3; -.
DR   MassIVE; Q86YD3; -.
DR   PaxDb; Q86YD3; -.
DR   PeptideAtlas; Q86YD3; -.
DR   PRIDE; Q86YD3; -.
DR   ProteomicsDB; 34043; -.
DR   ProteomicsDB; 70400; -. [Q86YD3-1]
DR   ProteomicsDB; 70401; -. [Q86YD3-2]
DR   ProteomicsDB; 70402; -. [Q86YD3-3]
DR   ProteomicsDB; 70403; -. [Q86YD3-4]
DR   Antibodypedia; 2512; 63 antibodies.
DR   DNASU; 84866; -.
DR   Ensembl; ENST00000313236; ENSP00000315635; ENSG00000149582. [Q86YD3-1]
DR   Ensembl; ENST00000354064; ENSP00000278959; ENSG00000149582. [Q86YD3-3]
DR   Ensembl; ENST00000354284; ENSP00000346237; ENSG00000149582. [Q86YD3-4]
DR   Ensembl; ENST00000359862; ENSP00000352924; ENSG00000149582. [Q86YD3-2]
DR   Ensembl; ENST00000411589; ENSP00000411882; ENSG00000149582. [Q86YD3-2]
DR   Ensembl; ENST00000442938; ENSP00000416071; ENSG00000149582. [Q86YD3-5]
DR   Ensembl; ENST00000524725; ENSP00000431205; ENSG00000149582. [Q86YD3-2]
DR   GeneID; 84866; -.
DR   KEGG; hsa:84866; -.
DR   UCSC; uc001pth.4; human. [Q86YD3-1]
DR   CTD; 84866; -.
DR   DisGeNET; 84866; -.
DR   EuPathDB; HostDB:ENSG00000149582.15; -.
DR   GeneCards; TMEM25; -.
DR   HGNC; HGNC:25890; TMEM25.
DR   HPA; ENSG00000149582; Low tissue specificity.
DR   MIM; 613934; gene.
DR   neXtProt; NX_Q86YD3; -.
DR   OpenTargets; ENSG00000149582; -.
DR   PharmGKB; PA134919013; -.
DR   eggNOG; ENOG410IF2Y; Eukaryota.
DR   eggNOG; ENOG410ZNWF; LUCA.
DR   GeneTree; ENSGT00990000203554; -.
DR   InParanoid; Q86YD3; -.
DR   KO; K22652; -.
DR   OrthoDB; 914115at2759; -.
DR   PhylomeDB; Q86YD3; -.
DR   TreeFam; TF333068; -.
DR   BioGRID-ORCS; 84866; 1 hit in 789 CRISPR screens.
DR   ChiTaRS; TMEM25; human.
DR   GeneWiki; TMEM25; -.
DR   GenomeRNAi; 84866; -.
DR   Pharos; Q86YD3; Tdark.
DR   PRO; PR:Q86YD3; -.
DR   Proteomes; UP000005640; Chromosome 11.
DR   RNAct; Q86YD3; protein.
DR   Bgee; ENSG00000149582; Expressed in cerebellum and 149 other tissues.
DR   ExpressionAtlas; Q86YD3; baseline and differential.
DR   Genevisible; Q86YD3; HS.
DR   GO; GO:0005576; C:extracellular region; IEA:UniProtKB-SubCell.
DR   GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW.
DR   GO; GO:0005770; C:late endosome; ISS:UniProtKB.
DR   GO; GO:0005764; C:lysosome; ISS:UniProtKB.
DR   GO; GO:0005886; C:plasma membrane; IEA:UniProtKB-SubCell.
DR   GO; GO:0090394; P:negative regulation of excitatory postsynaptic potential; ISS:UniProtKB.
DR   GO; GO:0031647; P:regulation of protein stability; ISS:UniProtKB.
DR   Gene3D; 2.60.40.10; -; 1.
DR   InterPro; IPR013162; CD80_C2-set.
DR   InterPro; IPR007110; Ig-like_dom.
DR   InterPro; IPR036179; Ig-like_dom_sf.
DR   InterPro; IPR013783; Ig-like_fold.
DR   InterPro; IPR042864; TMEM25.
DR   PANTHER; PTHR47224; PTHR47224; 1.
DR   Pfam; PF08205; C2-set_2; 1.
DR   SUPFAM; SSF48726; SSF48726; 1.
DR   PROSITE; PS50835; IG_LIKE; 1.
PE   1: Evidence at protein level;
KW   Alternative splicing; Cell membrane; Direct protein sequencing;
KW   Disulfide bond; Endosome; Glycoprotein; Immunoglobulin domain; Lysosome;
KW   Membrane; Polymorphism; Reference proteome; Secreted; Signal;
KW   Transmembrane; Transmembrane helix.
FT   SIGNAL          1..26
FT                   /evidence="ECO:0000269|PubMed:15340161"
FT   CHAIN           27..366
FT                   /note="Transmembrane protein 25"
FT                   /id="PRO_0000014984"
FT   TOPO_DOM        27..232
FT                   /note="Extracellular"
FT                   /evidence="ECO:0000255"
FT   TRANSMEM        233..253
FT                   /note="Helical"
FT                   /evidence="ECO:0000255"
FT   TOPO_DOM        254..366
FT                   /note="Cytoplasmic"
FT                   /evidence="ECO:0000255"
FT   DOMAIN          30..123
FT                   /note="Ig-like"
FT   CARBOHYD        106
FT                   /note="N-linked (GlcNAc...) asparagine"
FT                   /evidence="ECO:0000255"
FT   CARBOHYD        162
FT                   /note="N-linked (GlcNAc...) asparagine"
FT                   /evidence="ECO:0000255"
FT   CARBOHYD        175
FT                   /note="N-linked (GlcNAc...) asparagine"
FT                   /evidence="ECO:0000255"
FT   CARBOHYD        192
FT                   /note="N-linked (GlcNAc...) asparagine"
FT                   /evidence="ECO:0000255"
FT   CARBOHYD        205
FT                   /note="N-linked (GlcNAc...) asparagine"
FT                   /evidence="ECO:0000255"
FT   DISULFID        52..107
FT                   /evidence="ECO:0000255|PROSITE-ProRule:PRU00114"
FT   VAR_SEQ         24..128
FT                   /note="GWGELEPQIDGQTWAERALRENERHAFTCRVAGGPGTPRLAWYLDGQLQEAS
FT                   TSRLLSVGGEAFSGGTSTFTVTAHRAQHELNCSLQDPRSGRSANASVILNVQF -> V
FT                   (in isoform 3)"
FT                   /evidence="ECO:0000303|PubMed:14702039"
FT                   /id="VSP_012939"
FT   VAR_SEQ         225..268
FT                   /note="Missing (in isoform 2, isoform 3 and isoform 5)"
FT                   /evidence="ECO:0000303|PubMed:12975309,
FT                   ECO:0000303|PubMed:14702039, ECO:0000303|PubMed:15489334,
FT                   ECO:0000303|PubMed:16303743"
FT                   /id="VSP_012940"
FT   VAR_SEQ         313
FT                   /note="Missing (in isoform 5)"
FT                   /evidence="ECO:0000303|PubMed:16303743"
FT                   /id="VSP_045635"
FT   VAR_SEQ         344..366
FT                   /note="FIRLPVLGYIYRVSSVSSDEIWL -> RRNQDKDA (in isoform 4
FT                   and isoform 5)"
FT                   /evidence="ECO:0000303|PubMed:14702039,
FT                   ECO:0000303|PubMed:16303743"
FT                   /id="VSP_012941"
FT   VARIANT         25
FT                   /note="W -> C (in dbSNP:rs35915434)"
FT                   /id="VAR_033623"
FT   VARIANT         342
FT                   /note="Q -> R (in dbSNP:rs12289253)"
FT                   /evidence="ECO:0000269|PubMed:15489334,
FT                   ECO:0000269|PubMed:16303743"
FT                   /id="VAR_021391"
FT   CONFLICT        277
FT                   /note="I -> V (in Ref. 3; BAC11620)"
FT                   /evidence="ECO:0000305"
SQ   SEQUENCE   366 AA;  39285 MW;  82B06A7B55A10129 CRC64;
     MALPPGPAAL RHTLLLLPAL LSSGWGELEP QIDGQTWAER ALRENERHAF TCRVAGGPGT
     PRLAWYLDGQ LQEASTSRLL SVGGEAFSGG TSTFTVTAHR AQHELNCSLQ DPRSGRSANA
     SVILNVQFKP EIAQVGAKYQ EAQGPGLLVV LFALVRANPP ANVTWIDQDG PVTVNTSDFL
     VLDAQNYPWL TNHTVQLQLR SLAHNLSVVA TNDVGVTSAS LPAPGLLATR VEVPLLGIVV
     AAGLALGTLV GFSTLVACLV CRKEKKTKGP SRHPSLISSD SNNLKLNNVR LPRENMSLPS
     NLQLNDLTPD SRAVKPADRQ MAQNNSRPEL LDPEPGGLLT SQGFIRLPVL GYIYRVSSVS
     SDEIWL
//
DBGET integrated database retrieval system