KEGG   Streptococcus pyogenes MGAS10394 (serotype M6): M6_Spy0265Help
Entry
M6_Spy0265        CDS       T00191                                 

Definition
(GenBank) Glyceraldehyde 3-phosphate dehydrogenase
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
spa  Streptococcus pyogenes MGAS10394 (serotype M6)
Pathway
spa00010  Glycolysis / Gluconeogenesis
spa01100  Metabolic pathways
spa01110  Biosynthesis of secondary metabolites
spa01120  Microbial metabolism in diverse environments
spa01130  Biosynthesis of antibiotics
spa01200  Carbon metabolism
spa01230  Biosynthesis of amino acids
Module
spa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
spa_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:spa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M6_Spy0265
Enzymes [BR:spa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     M6_Spy0265
Membrane trafficking [BR:spa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    M6_Spy0265
Exosome [BR:spa04147]
 Exosomal proteins
  Proteins found in most exosomes
   M6_Spy0265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N 2-Hacid_dh_C DapB_N
Motif
Other DBs
NCBI-ProteinID: AAT86400
UniProt: Q5XDW3
Position
272238..273275
Genome map
AA seq 345 aa AA seqDB search
MIFIRRKSLMVVKVGINGFGRIGRLAFRRIQNIEGVEVTRINDLTDPNMLAHLLKYDTTQ
GRFDGTVEVKEGGFEVNGNFIKVSAERDPENIDWATDGVEIVLEATGFFAKKEAAEKHLH
ANGAKKVVITAPGGNDVKTVVFNTNHDILDGTETVISGASCTTNCLAPMAKALHDAFGIQ
KGLMTTIHAYTGDQMILDGPHRGGDLRRARAGAANIVPNSTGAAKAIGLVIPELNGKLDG
AAQRVPVPTGSVTELVVTLDKNVSVDEINAAMKAASNDSFGYTEDPIVSSDIVGVSYGSL
FDATQTKVMEVDGSQLVKVVSWYDNEMSYTAQLVRTLEYFAKIAK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
ttgattttcataaggaggaaatcactaatggtagttaaagttggtattaacggtttcggt
cgtatcggacgtcttgcattccgccgtattcaaaacatcgaaggtgttgaagtaactcgt
atcaatgaccttacagatccaaatatgcttgcacacttgttgaaatacgatacaactcaa
ggtcgttttgatggaacagttgaagttaaagaaggtggatttgaagtaaacggaaacttc
atcaaagtttctgctgaacgtgatccagaaaacatcgactgggcaactgatggggttgaa
atcgttcttgaagcaactggtttctttgctaaaaaagaagcagctgaaaaacacttacat
gctaacggtgctaaaaaagttgttatcacagctcctggtggaaacgatgttaaaacagtt
gttttcaacactaaccacgacattcttgacggtactgaaacagttatctcaggtgcttca
tgtactacaaactgtttagctcctatggctaaagctcttcacgatgcattcggtattcaa
aaaggtcttatgactacaatccacgcttacactggtgaccaaatgatccttgacggacca
caccgtggtggtgatcttcgtcgtgcacgcgctggtgctgcaaatatcgttcctaactca
actggtgctgctaaagctatcggtcttgttatcccagaacttaacggtaaacttgacggt
gctgcacaacgtgttcctgttccaactggatcagtaactgagttggttgtaactcttgac
aaaaacgtttctgttgacgaaatcaacgctgctatgaaagctgcttcaaacgatagcttc
ggttacactgaagatccaatcgtttcttcagatatcgtaggcgtatcatacggttcattg
tttgacgcaactcaaactaaagtaatggaagttgacggatcacaattggttaaagttgta
tcatggtatgacaacgaaatgtcttacactgctcaacttgtacgtactcttgagtacttc
gcaaaaattgctaaataa

DBGET integrated database retrieval system