KEGG   Streptococcus pyogenes MGAS10394 (serotype M6): M6_Spy0819Help
Entry
M6_Spy0819        CDS       T00191                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
spa  Streptococcus pyogenes MGAS10394 (serotype M6)
Pathway
spa00790  Folate biosynthesis
spa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    M6_Spy0819
Enzymes [BR:spa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     M6_Spy0819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI BCDHK_Adom3
Motif
Other DBs
NCBI-ProteinID: AAT86954
UniProt: Q5XCA9
Position
824946..825554
Genome map
AA seq 202 aa AA seqDB search
MKRKRKKLMKRERLMSINKEKAEAAIYQFLEAIGENPNREGLLDTPKRVAKMYAEMFLGL
GKDPKEEFTAVFKEQHEDVVIVKDISFYSICEHHLVPFYGKAHIAYLPSDGRVTGLSKLA
RAVEVASKRPQLQERLTSQIADALVEALNPKGTLVMVEAEHMCMTMRGIKKPGSKTITTT
ARGLYKESRAERQEVISLMTKD
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggaaaaggaaaaaactaatgaaaagggaaagactaatgtctattaataaggaa
aaagcagaagcagccatttatcagtttttagaggctattggtgaaaatccaaatcgggaa
ggtcttcttgacacgcctaaacgggttgctaaaatgtatgcggagatgtttttgggactg
ggaaaagatcctaaagaggagtttacggctgtctttaaagaacaacatgaggatgtggtg
attgtcaaagacattagtttttattctatatgtgaacaccacttagttcctttttatggc
aaggctcatatcgcttacttgccaagtgatggtcgagtaacaggtttgagtaaattagcg
cgagcagttgaagtagctagtaaacgacctcaactccaagagcgtttgacctctcaaata
gcggatgctttagttgaagccctcaatcctaaagggactttagttatggtagaagcagag
cacatgtgcatgaccatgcgaggcatcaaaaagccaggtagtaaaaccattaccaccact
gccagaggcttatataaggaaagtcgtgctgagaggcaagaagttatttctctaatgaca
aaagattag

DBGET integrated database retrieval system