KEGG   Streptococcus pyogenes MGAS10394 (serotype M6): M6_Spy1390Help
Entry
M6_Spy1390        CDS       T00191                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
spa  Streptococcus pyogenes MGAS10394 (serotype M6)
Pathway
spa00071  Fatty acid degradation
spa00072  Synthesis and degradation of ketone bodies
spa00280  Valine, leucine and isoleucine degradation
spa00310  Lysine degradation
spa00362  Benzoate degradation
spa00380  Tryptophan metabolism
spa00620  Pyruvate metabolism
spa00630  Glyoxylate and dicarboxylate metabolism
spa00640  Propanoate metabolism
spa00650  Butanoate metabolism
spa00900  Terpenoid backbone biosynthesis
spa01100  Metabolic pathways
spa01110  Biosynthesis of secondary metabolites
spa01120  Microbial metabolism in diverse environments
spa01130  Biosynthesis of antibiotics
spa01200  Carbon metabolism
spa01212  Fatty acid metabolism
spa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:spa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    M6_Spy1390
   00630 Glyoxylate and dicarboxylate metabolism
    M6_Spy1390
   00640 Propanoate metabolism
    M6_Spy1390
   00650 Butanoate metabolism
    M6_Spy1390
  09103 Lipid metabolism
   00071 Fatty acid degradation
    M6_Spy1390
   00072 Synthesis and degradation of ketone bodies
    M6_Spy1390
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    M6_Spy1390
   00310 Lysine degradation
    M6_Spy1390
   00380 Tryptophan metabolism
    M6_Spy1390
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    M6_Spy1390
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    M6_Spy1390
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    M6_Spy1390
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spa04147]
    M6_Spy1390
Enzymes [BR:spa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     M6_Spy1390
Exosome [BR:spa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   M6_Spy1390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: AAT87525
UniProt: Q5XAN8
Position
1384126..1385313
Genome map
AA seq 395 aa AA seqDB search
MKNIVIVEALRTPIGAFGGSFKSVSAVELGTTVLKKILDKTQVKPEMVDEVILGNVLHAG
LGQNVARQVAIHSGIPEDKTAFTLDMVCGSGLKAIQLAAQSIMLGDADIVIAGGVENMSQ
AAYVSTQHRFGQRLGNSQLIDTLVHDGLTDAFNNYHMGITAENVAQKYGISREEQDQFAL
ESQEKAAKALENHRFADEIVPVSVPQRRKDPLIVTTDEYPKVDTSLEKLQQLRPAFFPKE
GTVTAGNASGINDGAALLMLMTEEKALELGLTPLVTIESYASAGVAPELMGTGPIPATQK
ALKKAGLTISDLDLVESNEAFAAQSLAVLKDLKLNPEIVNVNGGAIALGHPIGASGARIL
VTLIHEMKKRQVTRGLATLCIGGGQGTAVIVKNNT
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacatagttatcgttgaagctttacgaactcctatcggagcttttggaggctcc
tttaaaagtgtctctgctgttgaacttggaacaactgtactgaaaaaaatccttgataaa
acgcaagtaaagcctgaaatggttgatgaagtcatcctaggaaacgtccttcatgcaggc
ctaggacaaaatgtggcaagacaagttgcaatccactcaggaattcctgaagataaaaca
gctttcacattagatatggtttgcggttctggacttaaagccatccaattagctgcgcaa
agcatcatgcttggtgacgctgatatcgttattgctggtggtgtcgaaaacatgtcacag
gcagcctatgtgtcaactcagcaccgttttggacagcgacttggtaatagtcaattgatt
gatactcttgttcatgatggattgacagatgctttcaacaattatcatatgggtattact
gctgaaaacgttgctcagaaatatggcatctcaagagaagagcaagatcaatttgcttta
gaaagccaagaaaaagctgctaaggcattagaaaatcatcgttttgctgacgaaattgtc
cctgtctctgtacctcaacgacgcaaagaccctttaattgttacaacagatgaataccca
aaagttgacacaagccttgaaaaattacagcaattacgtcctgccttcttccctaaagaa
ggaaccgttactgctgggaatgcctcaggaataaacgatggtgcagccttattgatgtta
atgactgaagaaaaagctcttgaattagggttaacacctttagtcactattgaaagctat
gctagtgcaggtgttgcacctgaactgatgggaactggaccaattcctgccactcaaaaa
gcccttaagaaagctggattaacaatttctgatttggacttagtggagtccaatgaagca
tttgcagcacagtccttggcggttttaaaagatttaaagttaaacccagaaatcgtgaat
gttaatggaggagccatcgctttaggtcatcctattggtgccagtggcgctcgcattcta
gtcacattaatccacgaaatgaaaaaacgccaagtaaccagaggactagcaacactttgc
attggtggaggacaaggaactgctgttatcgtgaaaaacaatacttag

DBGET integrated database retrieval system