KEGG   Spathaspora passalidarum: SPAPADRAFT_154610Help
Entry
SPAPADRAFT_154610 CDS       T03101                                 

Definition
(RefSeq) acyl-coenzyme A oxidase 4
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
spaa  Spathaspora passalidarum
Pathway
spaa00071  Fatty acid degradation
spaa00592  alpha-Linolenic acid metabolism
spaa01040  Biosynthesis of unsaturated fatty acids
spaa01100  Metabolic pathways
spaa01110  Biosynthesis of secondary metabolites
spaa01212  Fatty acid metabolism
spaa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:spaa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SPAPADRAFT_154610
   00592 alpha-Linolenic acid metabolism
    SPAPADRAFT_154610
   01040 Biosynthesis of unsaturated fatty acids
    SPAPADRAFT_154610
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    SPAPADRAFT_154610
Enzymes [BR:spaa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     SPAPADRAFT_154610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_ox_N Acyl-CoA_dh_1 DUF1655 DUF3209
Motif
Other DBs
NCBI-GeneID: 18870991
NCBI-ProteinID: XP_007376225
JGI: 154610
UniProt: G3AQA0
Position
Unknown
AA seq 709 aa AA seqDB search
MAIATNTVNISQGPDPKTSIQNERANSKFDPVKMHYFLEGSKERAEELKSLMQQMERDPV
LFTDASYYDLTKDQQRALTAVKINRVSRYLEGDSIDTFNKRLSLIGLFDPQVATRIGVNL
GLFISCVRGNGTYEQLKYWALDKETAHIKGIYGCFGMTELAHGSNVSGLETTATFDKDTD
EFVINTPHIGATKWWIGGAAHSATHTTCYARLIVDGEDYGVKTFVVPLRDSNHDLMPGIS
VGDIGSKMGRDGIDNGWIQFSNVRIPRFFMLQKFCKVSREGKVILPPLEQLSYSALLGGR
VMMVLDSYRMIARMSTIALRYAIGRRQFKGDNVDPDDENALETQLLDYPLHQKRLLPYLA
AAYVFATGAVRIEQTIDETLSDLDDAVDQNDDEAIMKSIDAMKSLFIDSGSLKSTCTWLA
AEAIDQCRQACGGHGYSAYSGFGKAYNDFVVQCTWEGDNNILGVNIGKPLVKHVLAIEDD
GKVVKGSSSFLNNLKQYTGSNATNVILDNVADLNDLKKVAKAVEIAIIRLAHQAATTARK
NSLDYVGAELVTLSKLKAHHYLLNEYVVRLERFEEKDLIPYLVSLGRLYAATMVLERFAG
IFLTFNVVSPSVMAALTSNQIPQLCKEVRPHVVALTDSFQQSDMLVNSVLGKYDGDIYEN
YFGTVKTLNKPSNTKAPYSGALEAMLNRPSIEERERFEKTVETGEILSR
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgcaacaaatactgtcaacatatcccaaggtccagacccaaagactctgatt
caaaatgaaagagcaaactccaagtttgatcctgtcaagatgcactacttcttggaaggt
tctaaggaaagagctgaagaattgaagtccttgatgcaacaaatggaaagagatccagtc
ttgtttactgatgcctcttactatgatttgaccaaggaccaacaaagagctttgactgct
gtcaagatcaaccgtgtctccagatatttggaaggtgattccattgatactttcaacaag
agattgtctttgattggtctttttgaccctcaagttgctactagaatcggtgttaacttg
ggtttatttatttcctgtgttagaggtaacggtacttacgagcaattgaaatactgggct
ttagataaggaaactgcccatatcaagggtatttacggttgttttggtatgaccgaattg
gcccacggttcaaatgtcctgggtcttgaaaccactgctactttcgacaaagataccgat
gaatttgttattaacactccacatattggtgccaccaaatggtggattggaggtgctgct
cattctgctactcacaccacttgttacgctagattaattgttgatggtgaagattacggt
gtcaagacttttgttgttccattaagagactcgaaccacgaccttatgccaggtatctct
gttggtgatattggttccaagatgggtagagatggtattgataacggttggattcaattc
tccaatgttagaattccaagattctttatgttgcaaaagttctgtaaagtctccagagaa
ggtaaggttatcttgccaccattggaacaattatcttactctgctttattaggtggtaga
gttatgatggttttggattcatacagaatgattgccagaatgtccactattgccttgaga
tacgccattggtagaagacaatttaagggtgacaatgttgaccctgatgatgaaaatgca
cttgaaactcaattattggactacccattacatcaaaagagattgttaccttacttggct
gctgcttacgtctttgctactggtgcagttagaattgaacaaactattgacgaaacctta
tctgacttggatgacgctgttgaccaaaatgatgatgaagctattatgaagtctattgat
gccatgaagtccttatttatcgactctggttccttgaaatctacctgtacttggttagct
gctgaagctattgaccaatgtagacaagcttgtggtggacatggttactccgcttacagt
ggtttcggtaaagcttacaatgatttcgttgttcaatgtacttgggaaggtgataacaat
atcttgggtgttaacatcggtaagccattggttaagcacgttcttgctattgaagatgat
ggtaaggttgttaaaggaagttctagtttcttgaacaatttgaagcaatatactggttct
aatgctacaaatgttatcttggacaatgttgctgacttgaatgatctcaagaaggtcgct
aaggctgttgaaattgccatcatcagattggctcaccaagctgctaccactgctagaaag
aactcgcttgactatgttggtgctgaattagttaccttgtctaagttgaaggcacaccac
tacttgttgaatgaatatgttgtcagacttgaaagatttgaagaaaaggatttgattcca
tacttggtttctttgggtagattatatgctgctactatggttttggaaagatttgctggt
atcttcttgaccttcaatgttgtttctccaagtgttatggctgctttgacctccaatcaa
attccacaattgtgtaaagaagtcagaccacatgtcgttgcccttactgattccttccaa
caatctgatatgcttgtcaactctgttcttggtaagtatgatggtgacatttacgaaaac
tactttggcactgtcaagaccttgaacaagccttctaacactaaggctccttactctggt
gctttagaagccatgttgaatagaccatctattgaagaaagagaaagatttgaaaagact
gttgaaactggtgaaatcttatctagataa

DBGET integrated database retrieval system