KEGG   Spathaspora passalidarum: SPAPADRAFT_59618Help
Entry
SPAPADRAFT_59618  CDS       T03101                                 

Definition
(RefSeq) hypothetical protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
spaa  Spathaspora passalidarum
Pathway
spaa00260  Glycine, serine and threonine metabolism
spaa01100  Metabolic pathways
spaa01110  Biosynthesis of secondary metabolites
spaa01130  Biosynthesis of antibiotics
spaa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:spaa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPAPADRAFT_59618
Enzymes [BR:spaa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     SPAPADRAFT_59618
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 18872992
NCBI-ProteinID: XP_007373771
JGI: 59618
UniProt: G3AHM3
Position
Unknown
AA seq 275 aa AA seqDB search
MDFSNFSAQSPAHNEFRSDTFTTPTLSMIQSLGKSTLGDAVYNEDQATIALEEKLASMTG
KEAGLYCVSGTLSNQIAMRVHLLQPPYSVLCDHRAHVYVHEAAGLSTLSQAMPQPIIPKN
GIHLTLEDDILPNFIPDDGEIHGAPTKLICLENTLHGMLFPLDEIKKISAFCKANDVKLH
LDGARLWNAHVETGIPLEEYCSHFDSVSLCLSKTLGAPIGTVLVGNKKFILKANHFKKQN
GGGIRQSGLLATMAMTAIEENLPKLKKTHDQAKEL
NT seq 826 nt NT seq  +upstreamnt  +downstreamnt
atggatttctccaacttttctgcccaaagtcctgctcacaatgagttccgtagtgataca
ttcaccacacccaccttgtccatgatccaatctcttggcaagtctactttaggagatgca
gtatacaatgaagatcaagccaccattgccttggaggaaaaactagcttccatgactggt
aaagaagcagggttgtactgcgtaagtggtactctttccaaccaaatcgccatgagagtc
cacttgttacagcctccatatagtgttttatgtgaccatcgtgcccatgtttatgttcat
gaagctgctgggttatctacattatcccaagctatgcctcaaccaatcatccctaaaaac
ggtatccacttaacattagaagacgacatcttgcctaacttcattcctgatgatggtgaa
attcatggtgctccaaccaaattgatttgcttggagaacactttacacggaatgttattc
cctcttgacgagattaaaaagatttctgcattctgtaaagccaatgatgtaaagttgcat
ttagatggggcaagattatggaatgcacacgttgaaacaggaatcccccttgaagaatat
tgtagtcatttcgatagtgtatcactttgcttgtctaaaaccttgggtgcacctatcgga
actgtccttgtaggaaacaaaaaattcatcctcaaggctaaccattttaagaagcagaat
ggtggtggtataagacaaagtggtcttttggcaaccatggccatgacagcaattgaggag
aatttaccaaaattgaaaaaaacacatgaccaagctaaggaattag

DBGET integrated database retrieval system