KEGG   Spathaspora passalidarum: SPAPADRAFT_59987Help
Entry
SPAPADRAFT_59987  CDS       T03101                                 

Definition
(RefSeq) hypothetical protein
  KO
K05355  hexaprenyl-diphosphate synthase [EC:2.5.1.82 2.5.1.83]
Organism
spaa  Spathaspora passalidarum
Pathway
spaa00900  Terpenoid backbone biosynthesis
spaa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spaa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SPAPADRAFT_59987
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:spaa01006]
    SPAPADRAFT_59987
Enzymes [BR:spaa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.82  hexaprenyl diphosphate synthase [geranylgeranyl-diphosphate specific]
     SPAPADRAFT_59987
    2.5.1.83  hexaprenyl diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific]
     SPAPADRAFT_59987
Prenyltransferases [BR:spaa01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   SPAPADRAFT_59987
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-GeneID: 18873166
NCBI-ProteinID: XP_007374143
JGI: 59987
UniProt: G3AJ47
Position
Unknown
AA seq 481 aa AA seqDB search
MLSIRRRILKNSVSLLRCSSTRIVTPPNTFTTAVKTAEKLVQPQSSKIFDDPFSIVSHEM
SNLAKSIANLIGSGHPILNRVSSYYFEAEGKNVRPLIVLLLSKALSNIPVEQRNRIEIDT
HDVTDQYHFKGTPGSKETIAGKSVDDSISPLAILHGINPKVILDPLSKPMDKLPQFDAMN
GILPKQRRLAEIVEMIHTASLLHDDVIDLSDSRRGRPSGNIAFTNKMAVLAGDFLLGRAS
VAIARLRNPEVIELLSTTIANLVEGEFMQLKNTVMSQSDTIVNDGEKKTIPEPTGKVPTK
QHEYSISRPEDVDHITNVNAAFEYYLHKTYLKTASLMSKSSRAAAVLSGSQDDIIENCYE
FGRNLGLCFQIVDDMLDYTSSDAAFGKPSQADLKLGLATAPILFAWKEEPKLGELIARKF
KEPGDVEIARRAVEKYGGLDQTRLMAEDYCHKALTNLRCLPESDARSALELLTNSVLTRN
K
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgctcctgataagacgaaggatattgaagaactcggtttctctcttgagatgctcgtct
acaagaatagtaactccgccaaatacattcaccaccgccgtcaagaccgctgaaaagttg
gtgcaaccgcaatcgtccaagatctttgacgacccgttctcaattgtcagccacgaaatg
tccaatttggccaagtccatagctaacttgatcggatccggacatccgatcctaaacaga
gtcagctcgtactatttcgaagccgagggaaagaacgtgcgtccgttgattgtcctttta
ttgtccaaggcgttgtctaatattcccgttgagcaaagaaacagaattgaaatagacacc
catgacgtgactgatcagtaccatttcaaaggcacacctggcagcaaagaaaccattgct
gggaagtctgtggacgattccatatcccccttggccattttgcacggaataaaccccaag
gttatattagacccattgctgaaacccatggacaagttgccacaatttgatgccatgaat
ggtatattaccaaagcaaagaagattagcggaaattgtcgagatgattcacactgcttcg
ttattgcatgacgacgttatagatttgagtgattcaagaagaggcagaccaagtgggaat
atagcctttactaacaagatggcggtgttggcaggtgacttcttattaggaagagcctcg
gtggccattgcccgattaagaaaccctgaggttattgagttgttatctaccacaatcgcc
aatttagtcgagggggaattcatgcaattgaaaaacaccgttatgtcacaatcagacaca
atcgttaatgacggagaaaagaagaccattcctgaacctaccggaaaagtacccaccaag
caacacgaatactcaataagtcgtcccgaagatgttgaccatatcactaatgtaaatgct
gcatttgaatattacttgcacaagacatatcttaaaacagcatctttaatgtccaagctg
tcccgtgccgcagctgttttaagcggatcccaagacgacataattgaaaactgttatgaa
ttcggaagaaacttggggttgtgtttccaaatcgtcgatgatatgttggattatacttcc
agtgacgctgctttcggtaagccgagtcaagccgatttgaagttgggattggccactgct
cctattttatttgcctggaaggaagagcctaaattgggtgagcttattgccagaaagttt
aaagaaccgggagatgttgaaattgctcgtagggctgtggagaagtatggtgggttggac
cagacaagattgatggcagaagactattgtcataaggcattaaccaacttgagatgtttg
ccagaatctgatgccagaagtgcattggaattgttaactaattctgtattgactagaaac
aaatag

DBGET integrated database retrieval system