KEGG   Spathaspora passalidarum: SPAPADRAFT_60137
Entry
SPAPADRAFT_60137  CDS       T03101                                 

Definition
(RefSeq) hypothetical protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
spaa  Spathaspora passalidarum
Pathway
spaa00100  Steroid biosynthesis
spaa01100  Metabolic pathways
spaa01110  Biosynthesis of secondary metabolites
Module
spaa_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:spaa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    SPAPADRAFT_60137
Enzymes [BR:spaa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     SPAPADRAFT_60137
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 18873234
NCBI-ProteinID: XP_007374303
JGI: 60137
UniProt: G3AMD7
Position
Unknown
AA seq 440 aa
MSLNPPTTHREFSGLPGAIGITLGLPTLITFFALITNQTYSIQGINLDINAVLNQLPNST
EGWIALCFDKQCWLAYLAWFGILVALDFILPGTAAQGVELRDGSKLNYKINGPAVSSVFV
AVLLARAWQVKGYFLPELQFVYDHQLELTLVTTIFSMLLAVFVYVCSFIPLTKPNGKGTH
ERILSVNGNTRNPIYDWFIGRELNPRIGTWDIKLFCELRPGMLLWLLINLSCVHQQYHQL
GKVTDSLILVNLLQAFYIFDGVLNENGLLTMIDVTTDGFGFMLSFGDLAWVPWAYSLQSR
YLSCPGNEIELGWTNLSLIVLVKVVGFYIFRSANKQKSDFRSGKLDHLKSIQTKTGSKLL
IDGWWGLSQHINYFGDWLIGWSWCLPTGFQTPLTYFYVIYFGTLLLHRQIRDETKCRGKY
GKDWEKYEKLVPYKIIPYIY
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgtcattaaatccaccaactacccatagagaattctctgggttaccaggagcaataggg
ataacattgggattacctacccttatcacattctttgcattaatcactaaccaaacatat
tcaatccaaggaataaatcttgacataaatgcagtgctcaatcagcttcccaacagcacc
gagggttggatagcgttatgttttgataagcaatgttggttagcttaccttgcctggttt
ggaatattagtagcgttagatttcattcttcctggaactgctgctcaaggtgttgagtta
cgtgatgggctgaagttgaattacaagattaatggtcctgctgtgtcttctgtatttgtg
gctgtattattagctcgtgcatggcaagtgaagggttactttttgcctgaattacaattt
gtttatgatcatcaattagaattgactcttgttaccactatattctcgatgttattggct
gttttcgtatatgtgtgttcgttcatccccttgaccaagcccaatggaaagggaacacat
gaaagaattctttctgtcaatgggaacactcgtaacccaatttatgattggtttattggt
cgtgaattgaaccctagaataggtacttgggacatcaagcttttctgtgaattaagacca
ggaatgttattatggttactcataaacttgtcatgcgtacaccaacaatatcaccaatta
ggaaaagttaccgattcgttaatattggttaatcttttacaagcattctatattttcgat
ggtgtactcaatgaaaatggattacttaccatgattgatgtcaccaccgatgggtttgga
tttatgttaagttttggagatttagcttgggttccatgggcatattctttacaatccaga
tacttgagttgtcctgggaacgaaattgaattaggctggacaaacttatctttaattgta
ttggtcaaggtggttggattctatatcttccgtagtgccaacaaacaaaagtcagacttc
agactgggtaagttggatcacttgaagagcattcagactaaaaccggttcaaaattactt
atcgatggttggtggggtctttcacaacatataaactactttggtgattggttaatcggt
tggtcttggtgtttgccaactgggtttcaaaccccattaacttacttctatgtcatttac
tttggaactttgttattgcatagacaaattagagatgagactaaatgtagaggcaaatat
ggcaaagactgggaaaaatacgaaaagttggttccttataaaattattccatacatttac
tag

DBGET integrated database retrieval system