KEGG   Spathaspora passalidarum: SPAPADRAFT_63281Help
Entry
SPAPADRAFT_63281  CDS       T03101                                 

Definition
(RefSeq) hypothetical protein
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
spaa  Spathaspora passalidarum
Pathway
spaa00260  Glycine, serine and threonine metabolism
spaa00630  Glyoxylate and dicarboxylate metabolism
spaa00670  One carbon pool by folate
spaa01100  Metabolic pathways
spaa01110  Biosynthesis of secondary metabolites
spaa01130  Biosynthesis of antibiotics
spaa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:spaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SPAPADRAFT_63281
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPAPADRAFT_63281
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SPAPADRAFT_63281
Enzymes [BR:spaa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     SPAPADRAFT_63281
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG
Motif
Other DBs
NCBI-GeneID: 18874675
NCBI-ProteinID: XP_007377417
JGI: 63281
UniProt: G3AU70
Position
Unknown
AA seq 395 aa AA seqDB search
MLRTSAKRFYSAPANLLKTPLHEAHVALGGKMVPYAGFEMPVLYNSQSHIDSHNWVRSKV
GLFDVSHMLQHKITGKDAKSLLQKITPIDLNSLPMNESSLSVLLNENGGIIDDCIITKHG
EDSFYMVTNAGCRAKDVEFIKKEAEAFGSSVNHNTFEGTLLAIQGPKAQELLQKFTNEDL
SKIYFGQTRFVKLSPIGATVHLARSGYTGEDGFELSIPSSNAAETKDSLNFFQSLIAEYP
DLVKPIGLAARDSLRLEAGMCLYGYELTEQITPVEASLSWLIPKARRDANAGFNGASKIL
SQINDKSLVTHRRIGVVSKGPSPREHFKIFSNDGSQEIGYITSGSPSPTLGGNIAQAYID
KKFKIGSDIKIEIRGKLRDGKITKLPFVASNLYKP
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgttaagaaccagtgctaaaagattctattctgctcctgctaatttattaaagacccca
ttacatgaagctcatgttgcccttggaggtaagatggtgccctacgctggctttgaaatg
ccagtattgtacaacagtcaatcccacatagattcccacaattgggtcagatctaaagtt
ggtttatttgatgtcagtcatatgttacaacataagatcaccggtaaggatgccaagagt
cttttacaaaagattaccccaattgatttgaacagtttaccaatgaacgaatctagttta
tcagtattgttgaatgaaaacggagggatcattgatgattgtattattactaaacatggt
gaagatagtttctatatggttaccaatgctggttgtagagctaaggatgttgagtttatc
aaaaaggaagctgaagcatttggatccctggttaaccacaatacctttgaaggtacttta
ttagccattcaaggaccaaaggctcaagaacttttacaaaaattcactaacgaagattta
tccaagatttactttggccaaaccagatttgttaagttgtctccaattggagctacagtt
catttagctagatctggatatactggggaagacgggttcgaattgtctattccttcatct
aatgctgctgaaaccaaggattcattaaactttttccaactgttaattgctgaatatcct
gatttagtcaaaccaatcgggttagctgcaagagattccttaagattagaagcaggtatg
tgcctttacggatatgaattaaccgagcaaatcaccccagtcgaagcttccttatcatgg
ttaattccaaaggctcgtcgtgatgccaatgcaggattcaatggtgcttctaagatttta
tcacaaatcaatgacaagtctttggtcacccatagaagaattggtgttgtttctaaggga
ccatcaccaagagagcattttaagattttcagcaatgatggaagccaagaaattgggtat
atcacttccggttctccatcacccactttaggtggtaatattgcccaagcatatatcgac
aaaaagtttaaaattggcagtgatataaagatcgaaattagaggcaagttaagagacgga
aagattactaaattgccatttgttgcaagtaacttatataagccttaa

DBGET integrated database retrieval system