KEGG   Spathaspora passalidarum: SPAPADRAFT_70946Help
Entry
SPAPADRAFT_70946  CDS       T03101                                 

Definition
(RefSeq) hypothetical protein
  KO
K11681  helicase SWR1 [EC:3.6.4.12]
Organism
spaa  Spathaspora passalidarum
Brite
KEGG Orthology (KO) [BR:spaa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:spaa03036]
    SPAPADRAFT_70946
Enzymes [BR:spaa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SPAPADRAFT_70946
Chromosome and associated proteins [BR:spaa03036]
 Eukaryotic Type
  Chromatin remodeling factors
   SWR1 complex
    SPAPADRAFT_70946
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNF2_N Helicase_C ResIII HSA DEAD E6
Motif
Other DBs
NCBI-GeneID: 18875351
NCBI-ProteinID: XP_007374529
JGI: 70946
UniProt: G3AKX1
Position
Unknown
AA seq 1610 aa AA seqDB search
MPPKKRGAAQRASARLRQSSQSQTTTKRTSDAPQQHVPVNGHKRRKTSQPNNSTPKEEKL
AHVLANLNLAVGELFSLTEYKSIVYWNPKDYSSGLPKTQVPELFQEFAEDSKYKIVWDEE
IENDKEVKNLPLRFQKKLLAEREQKLLDKFPFKNEVIERSHVIESQLLDSLEEEKDSRPQ
SKGKAHSVKQEEVKPDPKKKGKPTRRSKAAEEAEQVDEEQEEEVEEIEQDSEDDEVKYTL
PPPLVTHPSHIPKWRPTTEQMVEGNNQQEIIDFDPVPLQIIKSNSDTIEAPEVADKLRNF
LDNNYKNPIIDESNMPDFNNTAQEYESIMNQQFQLLKKISHKINNESSLELNGEKIERRK
IVLPQTSNIKLTDPFRNTGSVTPKLQGLQNNLTHHDYLLNQGIAFSKVHHQMRRQHQLRT
RKVTSMIEQHFKKKKGEKERLAREREQNLRKISRLAIQAVKKRWNQAYKVYQFIQQEKED
EIKQKKGREHLSQMLEHSTQLLEAQLASSREATADIESETLLSDEMNEGSDSDTFSSSSE
EEEELNGSAKEAENDMNLSIEELKKKYANMESSVEPSSNPERETEQDSEEEEEEEEEESD
DDGINVSQGLASLYGITEVESPAPVTPSTEYTEQEKEIIDKLNQEEQIDNSLLDSDDASS
ISDWESSENEADEEVEPEDDEEMEEVEETEEKPNGLASLFNNDIEDESDEDVEINEESGS
DDYMSTTDEEAEAEEKETSNGSLKSEEPTKQEQEDEEEEEVKVEEINGSMVKDVPLPSLL
RGTLRPYQKQGLNWLASLYNNNTNGILADEMGLGKTIQTIALISYLACEHHIWGPHLIIV
PTSVMLNWEMEFKKFAPGFKVLTYYGSPQQRAQKRKGWNKPDAFHVCITSYQLVVQDQQS
FKRRRWRYMILDEAHNIKNFRSTRWRALLNFNTENRLLLTGTPLQNNLMELWSLLYFLMP
SSKVNQAMPEGFANLDDFQQWFGRPVDKILEQTTMGGSSDLIDENERTTSKMDEETRNTV
ARLHQVLRPYLLRRLKKDVEKQMPGKYEHIVYCRLSKRQRFLYDDFMSRAKTKETLASGN
FLSIINCLMQLRKVCNHPDLFEVRPIVTSFAMPRSVSSFYQPTLQLVNKQLDKSNYKETI
NFNVLNLDITTRDNLNYFVCQSCDRLQSSKELEEQITQLNKLQNGVDSSDVDVTDYLKYY
QHLKAHAQSEVQEKLKQVLYLNSLRCSRKPLYGESLLRFLTIPVLDFTDEPFDKFSLTIP
QRVDAMGDTIEKFSIITPPVVALDMKDQIIPISTQRKVSNEIATNKIDNPFHKSQVKLSI
AFPDKSLLQYDCGKLQKLATLLQTLTAEGHRALIFTQMTKVLDILEQFLNIHGYRYMRLD
GATKIEDRQLLTEKFNRDNKIPVFILSTRSGGLGINLTGADTVIFYDSDWNPAMDKQCQD
RCHRIGQVRDVHIYRFVSEYTIESNILKKANQKRQLDNVVIQEGEFTTDYFGKFSVRDLV
SDNIVGDDVVDRTIDFSGDVKMGNVFAQAEDEEDRVAAGAALKEVAVDEEDFKEESKSVA
DTPSQTPAPPSTLAMNGGVMGIDDLGDQDFEEGIGHIDEYMLRFISDGYY
NT seq 4833 nt NT seq  +upstreamnt  +downstreamnt
atgccaccgaagaagagaggtgctgcccaaagagccctggccagactacgtcagagttca
caatctcaaaccaccaccaaacgaacgagtgacgccccacaacaacacgtacctgtaaat
ggccataaacgaaggaaaacgagtcaacccaacaattcaacaccaaaagaggaaaagttg
gcacacgttttggccaatttaaacttggctgtaggcgaattgttctcattaactgagtat
aagtcgatcgtatactggaatcctaaagattattcaagtggtttacccaagacacaagtt
cctgaactatttcaggagtttgctgaagattcaaagtataaaatagtatgggacgaagaa
attgagaacgataaggaagtcaagaacttaccactaagatttcagaagaagttgttggct
gaacgagagcaaaagctcttggataagtttccgtttaaaaacgaagtcatagaaagaagt
cacgtcatagagtctcaattattggatagtttggaagaggaaaaggattcccgccctcag
tcaaaggggaaagcgcactcagttaaacaggaagaagtaaagccagatcccaaaaagaag
gggaaaccaacaagacgctccaaagcagcagaagaagcagaacaagtagacgaggagcaa
gaggaagaagtagaagaaatagaacaagactcagaggatgatgaagtaaagtacacatta
ccaccacccctcgtcactcatccttcacatatccccaaatggagacccacaactgagcaa
atggtagaaggaaacaatcagcaagaaataatagactttgacccagtacctttacaaatc
ataaaatcaaacagtgacaccatagaagcaccagaagttgctgacaaattacggaatttc
ttggacaacaactacaagaacccaattattgatgaatccaacatgcctgatttcaataat
acagcccaagaatacgagtccattatgaatcaacaatttcaattattaaaaaagatatca
cataaaataaataatgaaagcagtttagaattaaatggagaaaagatcgaaagacggaag
attgtgctaccacaaacatcaaatataaaactcacggatccattccgaaacacgggttca
gtaacccccaaactccaaggacttcaaaacaatttaacccatcatgactatttactcaat
caaggtattgcattttcaaaagtgcaccatcaaatgagaagacaacatcaattgcggacc
aggaaagtgactctgatgattgaacaacatttcaaaaagaagaagggagagaaagaacga
cttgctcgtgaacgagaacaaaaccttcggaaaattagtcgattggctattcaagcagtt
aaaaagagatggaaccaggcgtataaagtatatcagttcattcaacaggagaaagaggac
gaaattaaacaaaagaagggaagagaacatttatcacaaatgttggaacattctactcag
ttattagaagcacaattggcatcttcgagagaagcaactgctgatattgaaagtgagact
ttgttaagcgatgaaatgaatgaaggtagtgattcagatacgttcagttctagttctgaa
gaagaggaagaacttaatggaagtgccaaggaggccgaaaatgatatgaatctttcaatt
gaagaattaaagaagaagtatgccaatatggaaagctcagtcgaaccttcttctaatcca
gaacgggaaactgaacaagattcagaagaagaagaagaagaagaagaagaagaatcagat
gatgacggtattaacgtaagccaaggtcttgcctctttgtatggaataactgaagttgaa
agtccagctcctgtcactccttccacggaatacaccgagcaagaaaaagaaataattgat
aaactcaatcaagaagaacaaattgataattcacttttagactctgatgatgccagtctg
atttctgattgggaatcttctgaaaatgaagctgatgaagaagtagaaccagaagatgac
gaagagatggaagaagttgaagaaacagaagagaaaccgaatggtcttgcaagcttattt
aataatgacatcgaggacgaatccgatgaagatgttgaaatcaacgaagaaagcggtagt
gatgattacatgtctaccacagacgaagaagccgaagcggaagaaaaagaaaccagtaac
ggttccttaaaatcagaagaacctacaaaacaagaacaagaagatgaagaagaagaagaa
gtcaaagttgaagaaattaatggttcaatggttaaagacgttccattaccttctctttta
cgaggtacacttagaccctatcaaaaacaaggtcttaattggttagccagtttatacaac
aacaacacaaacggtattcttgccgatgagatgggtttaggtaaaaccattcaaacaatt
gcattgatatcttatttggcatgtgaacaccacatttggggcccacatttaattattgtg
cctacttcagttatgttgaattgggaaatggagttcaagaagtttgcaccgggtttcaaa
gtgttgacgtattatggatctcctcagcaacgtgctcagaagaggaaaggatggaacaaa
ccagatgcatttcatgtatgtatcacgtcgtaccaattggtggttcaagatcaacaatca
ttcaagcgaagaagatggagatatatgattcttgacgaagcgcataatatcaagaacttt
agatctactcgttggcgagcattgttgaattttaatactgaaaatagattgcttttaacc
ggtacaccattacaaaacaacttgatggaattatggtcgttgttatatttcttaatgcct
tcatcaaaagttaatcaagctatgccggagggatttgccaatttggatgacttccagcaa
tggtttggtcgtcccgttgataaaatattggaacagaccaccatgggcggtagttctgat
ttaattgatgaaaatgaacgaaccactctgaaaatggatgaagaaacaagaaacaccgtg
gcgagattacatcaagtgttgcgtccatatttgcttagacgattaaagaaggatgtggaa
aaacaaatgccaggaaagtatgaacatattgtgtattgccgtctttctaaaagacagcga
ttcttgtatgatgatttcatgtcgagggctaagaccaaggaaactttggcatcggggaac
tttctttctattattaattgtttgatgcaattgagaaaagtttgtaaccatcctgatttg
tttgaagttagaccgattgtcacttcgttcgcaatgcctagatcagtatcttcgttttat
caaccaacgcttcagttggttaataaacagttggacaaatcgaattacaaggaaacaatc
aatttcaatgttcttaatcttgatattacaacccgagacaatttgaattattttgtttgt
caatcgtgtgatcgattgcaatcttcaaaagaattagaagaacagattactcaattgaat
aagctacagaatggggtagattcaagtgatgtggacgttactgattatttgaaatattat
cagcatttaaaggcacatgcgcaactggaagttcaggaaaagttgaaacaggtattatat
ttgaattcgttgagatgcagcagaaagccattgtatggagagtcattattacgtttcctt
actattccagttctagattttacagatgaaccatttgacaagttttctttgaccataccc
caacgagttgatgcgatgggtgacaccattgaaaagttctccattataacaccaccagta
gttgctctagatatgaaggatcaaattatacctatatcaacacagaggaaagttctgaat
gaaattgccactaataaaattgataatccattccacaagtctcaagttaagttatctatt
gcatttcctgataaatcactcttgcagtatgactgtggtaaactacagaagcttgctact
ttattacaaaccttgacggcggagggacatcgagcattgattttcacacaaatgacaaaa
gttcttgatattctcgaacaatttttgaatattcacggatatagatacatgagattagat
ggtgccaccaagattgaagaccgtcaacttctaactgagaagttcaatcgtgataacaag
atcccggtgtttatcttgtctactagatctggtgggttgggtatcaacttaactggtgcc
gatacagtcatcttttatgattccgattggaatcccgctatggataagcaatgtcaggat
cgttgtcatagaattgggcaagttagagatgtgcatatctatcgatttgtttctgaatac
actatcgaatcgaacattcttaaaaaggctaaccagaagagacagttggataatgtggtt
atccaggagggtgaattcaccacggattatttcggtaaattctctgtgcgtgatcttgtc
agtgataatattgtcggtgatgatgttgttgatagaaccattgatttctcaggagatgtt
aaaatgggtaatgtgttcgctcaagcggaagatgaagaggatagagttgctgctggagcc
gcgttgaaggaagttgctgttgatgaagaagatttcaaagaagagagtaaatcagtggct
gacactccttcacaaacacctgctccaccactgacgttggccatgaatggaggagtcatg
gggattgatgatttgggtgatcaagatttcgaagaaggtattggtcatattgatgagtat
atgttgagatttatctccgacggatactactag

DBGET integrated database retrieval system