KEGG   Sporosarcina pasteurii: E2C16_00200Help
Entry
E2C16_00200       CDS       T06007                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
spae  Sporosarcina pasteurii
Pathway
spae00020  Citrate cycle (TCA cycle)
spae00620  Pyruvate metabolism
spae01100  Metabolic pathways
spae01110  Biosynthesis of secondary metabolites
spae01120  Microbial metabolism in diverse environments
spae01130  Biosynthesis of antibiotics
spae01200  Carbon metabolism
Module
spae_M00009  Citrate cycle (TCA cycle, Krebs cycle)
spae_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:spae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    E2C16_00200
   00620 Pyruvate metabolism
    E2C16_00200
Enzymes [BR:spae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     E2C16_00200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO K_oxygenase FAD_binding_3 Pyr_redox HI0933_like FAD_binding_2 NAD_binding_8 Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: QBQ04239
Position
41242..42768
Genome map
AA seq 508 aa AA seqDB search
MSIKQTDVILIGAGVMSATLGALLKELAPDWKLTVFEKLSDVGEESSNEWNNAGTGHAAL
CELNYTVENPDGSVDITKALQINEQFQLSRQFWAYLVNQKLIHNPKDFIMPLPHMSYVSG
EDNVRFLQNRFKALTKSPLFHGMEYSEDPEKLAEWMPLMLQNRPLNEPIAATKIDSGTDV
NFGALTRMLFHHLKDQNVDIHNKHDVKDMKRTSDGLWEVKVKNLETGAVERHTAKFVFIG
AGGGSLHLLQKSGIPEGKQIGGFPVSGLFMVCNNPDIVEQHHAKVYGKASVGAPPMSVPH
LDTRYIDNRKSLLFGPFAGFTPKFLKEGSILDLPTSIKPHNIMTMLAAGAKEMSLTKYLI
QQLLLSKEQRMEELRSFIPNAKAEDWDLVVAGQRVQVIKDTVKGGKGTLQFGTEVVSAED
GSIAALLGASPGASTAVHVMLEVISKCFPEHLEAWAPKIKEMIPSYGVSLVDNPELFHEL
LNSTAEALELVEKSEVTEADEARVLEKV
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcaaacaaacagacgttattttaattggcgcaggtgtaatgagtgcgacgtta
ggggcgttgttgaaagagttggctccggattggaagttgacagtgtttgagaagttgtca
gatgtgggggaagaaagttcgaatgaatggaataacgcaggcaccggacatgctgcactt
tgtgaattgaattatacggttgaaaatccggatggttctgttgatattacgaaggcgtta
caaattaatgagcagtttcagctttcaaggcagttctgggcttatctagtcaaccaaaag
cttattcataatccgaaagactttattatgccattgccacatatgagttatgtcagtgga
gaagacaatgttcgttttttgcaaaaccgttttaaagcgcttacaaaaagccctcttttt
catggcatggaatattcggaggatccggagaagcttgcagagtggatgccacttatgtta
caaaatcgtccgcttaatgaaccaattgcggcaacaaaaatcgattcgggaacggacgtg
aattttggcgcgttaacacgtatgttatttcaccatttaaaggatcaaaatgttgatata
cataataaacatgatgtaaaagatatgaagcggacaagcgatggtttgtgggaagtaaaa
gtgaaaaaccttgaaacaggtgcggttgaacggcatacggcaaagtttgtttttattggt
gctggcggcggcagtttacatttattgcagaagtcaggaattccagaaggaaaacagatt
ggcggattcccggtaagcggcttattcatggtatgtaacaatccggatattgtagaacag
caccatgcaaaagtctacgggaaagcttcagtaggtgcacctccgatgtcagttccgcac
ctagatacgagatatatcgacaaccgaaagtctttattatttggaccttttgcaggtttt
acaccaaaatttttgaaggaaggttcaatactcgatttaccaacttcaatcaagccgcat
aatataatgacgatgctagcggcgggtgcgaaagaaatgtccttaacaaagtatttaatt
caacaactcttattatcaaaagaacagcgtatggaagagttgcgaagctttattccaaat
gcgaaagcggaagattgggacttagttgtcgcggggcaacgtgtacaggtgattaaagat
acggttaagggcggaaaaggaaccttacagtttggaacggaagtagtgagcgcggaggat
ggctcgattgctgcactacttggtgcatcaccaggtgcttcgacagccgttcatgtcatg
cttgaagtcattagtaaatgttttccagaacatctggaagcatgggcgcctaaaattaaa
gaaatgattccttcttatggtgtatcccttgtggacaacccagaacttttccatgaatta
ctcaattcgactgcggaagcgcttgaactagtggagaaatcggaagtgacagaagcagat
gaagcaagagttttagaaaaggtttaa

DBGET integrated database retrieval system