KEGG   Sphingomonas panacis: AWL63_03935Help
Entry
AWL63_03935       CDS       T04760                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
span  Sphingomonas panacis
Pathway
span00260  Glycine, serine and threonine metabolism
span01100  Metabolic pathways
span01110  Biosynthesis of secondary metabolites
span01120  Microbial metabolism in diverse environments
span01130  Biosynthesis of antibiotics
span01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:span00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AWL63_03935
Enzymes [BR:span01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     AWL63_03935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AOH83248
UniProt: A0A1B3Z745
Position
871852..872856
Genome map
AA seq 334 aa AA seqDB search
MRFFSDNAAPVHPAVFAAMAAHNMLDTAYDGDALSRSLDGRFSALFETEVRALWVPSGTA
ANCLALAALCPPFGGVVCHRDAHIQNDECGAPEFYTHGAKLMIGEGVGAKLTPDSIRAVI
DIIADDVHRVQPHAISITNATEYGMVYTPAEVTAIGALARARGLALHMDGARFANAVAHL
GCAPADLTWRAGVDALSFGFIKNGGMTAEALIFFKPELAADTLRRRKRAGLLLSKGRYLA
AQIIALLEDDRWIANGAAANAAARLLADAGSARLVYPVEANEVFLRVTPEEAAGLRALGF
DFYDWAPGEIRLVTSWNHTAEQVRPLAEAIAALP
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttcttctccgacaatgccgccccggtccatcccgccgtgttcgccgcgatggcc
gcgcacaacatgctcgacaccgcctatgacggcgacgcgctgagccgcagcctcgacggg
cgcttctcggcgctgttcgagaccgaggtccgcgcgctctgggtgccatcgggcacggcc
gccaattgccttgcgctggcggcactctgcccgccgttcggtggcgtggtctgccaccgc
gatgcgcatatccagaacgacgagtgcggcgcgcccgaattctatacgcacggcgccaaa
ctgatgatcggcgaaggcgtcggcgccaagctgacgcccgacagcatccgcgcggtgatc
gacatcatcgctgacgacgtccaccgcgtccagccgcacgccatctcgatcaccaacgcg
accgagtacgggatggtctatacccccgccgaagtcaccgcgatcggcgcactcgcgcgc
gcgcgcggcctcgcgctgcacatggacggggcgcgcttcgccaatgcggtcgcgcatctc
ggctgcgcgcccgccgacctgacgtggcgcgccggggtcgatgcgctgagcttcggcttc
atcaagaacggcgggatgaccgccgaggcgctgatcttcttcaagcccgagctcgccgcc
gacaccttgcgccgccgcaagcgcgctggtctgctgctgtcgaaggggcgctatctcgcc
gcgcagatcatcgcgttgctcgaggacgatcgatggatcgccaatggcgccgccgccaac
gccgccgcgcggctgctcgccgatgccgggagcgcgcggctggtctatccggtcgaggcg
aacgaggtgttcctgcgcgtgacgcccgaagaagcggctgggctgcgtgcgctcgggttc
gatttctacgattgggcgccgggcgagatccggctggtgacctcgtggaaccacaccgcc
gagcaggtgcgtccgctcgccgaggcgatcgccgcgcttccataa

DBGET integrated database retrieval system