KEGG   Sphingomonas panacis: AWL63_04345Help
Entry
AWL63_04345       CDS       T04760                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
span  Sphingomonas panacis
Pathway
span00071  Fatty acid degradation
span00072  Synthesis and degradation of ketone bodies
span00280  Valine, leucine and isoleucine degradation
span00310  Lysine degradation
span00362  Benzoate degradation
span00380  Tryptophan metabolism
span00620  Pyruvate metabolism
span00630  Glyoxylate and dicarboxylate metabolism
span00640  Propanoate metabolism
span00650  Butanoate metabolism
span00900  Terpenoid backbone biosynthesis
span01100  Metabolic pathways
span01110  Biosynthesis of secondary metabolites
span01120  Microbial metabolism in diverse environments
span01130  Biosynthesis of antibiotics
span01200  Carbon metabolism
span01212  Fatty acid metabolism
span02020  Two-component system
Brite
KEGG Orthology (KO) [BR:span00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AWL63_04345
   00630 Glyoxylate and dicarboxylate metabolism
    AWL63_04345
   00640 Propanoate metabolism
    AWL63_04345
   00650 Butanoate metabolism
    AWL63_04345
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AWL63_04345
   00072 Synthesis and degradation of ketone bodies
    AWL63_04345
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AWL63_04345
   00310 Lysine degradation
    AWL63_04345
   00380 Tryptophan metabolism
    AWL63_04345
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AWL63_04345
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AWL63_04345
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AWL63_04345
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:span04147]
    AWL63_04345
Enzymes [BR:span01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AWL63_04345
Exosome [BR:span04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AWL63_04345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AOH83314
UniProt: A0A1B3Z7A6
Position
967544..968725
Genome map
AA seq 393 aa AA seqDB search
MTNIYAVAVARTAIGSFGGTLKDQRPGDLGAHVGRAAIERAGIPPELVGNVVFGHVIPTH
PRDHFVARIAGVGAGVPLATPALTVNRLCGSGLQAILSAAQSIMLDDCTIALAGGTEVMS
RAAHYLPDLRWGKKMGDSTIIDGLNGALTDPFNEILMGVTAENVAKRYGISREQQDALAL
TSHHRATRAIAEGYFRDQIAPIEIATRQGKIAFDTDEYVRTGAKPGDFDSLRPVFQRDGG
TVTAGNASGINDGAAAVVLANDVSVRELGLTPLGRLVAYGHAGVDPAYMGIGPVPATRNA
LARAGLKIDDLDIIEANEAFAAQACAVAAELGLDPDKVNPNGSGIALGHPVGATGAIITA
KLLYELRRTNKRYGLTTMCIGGGQGIAAIWERA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaacatctatgcggtcgccgtcgcccgtaccgcgatcggcagtttcggcggcacc
ctcaaggaccagcgcccgggtgatctcggggcgcatgtcggccgcgcggcgatcgaacgc
gcgggcattccaccggaactcgtcggcaatgttgttttcggccatgtcatcccgacccat
ccacgcgaccatttcgtcgcgcggatcgccggagtcggcgcgggcgtaccgctcgcgaca
ccggcgcttaccgtcaaccggctctgcggttcgggtttgcaggcgatcctgtccgccgcg
caatcgatcatgctggacgattgcacgatagcgctggcgggcgggacggaagtgatgagc
cgcgcggcgcattatctgcccgatctgcgctggggcaagaagatgggcgacagcacgatc
atcgacggcctcaacggcgcactaacagatccgttcaacgagatcctgatgggcgtgacc
gcggagaacgtcgcgaaacgctacggtatttcgcgggagcagcaggacgcgctggcactg
accagccaccaccgcgccacccgcgcgatcgcggaaggatacttcagggatcagatcgcc
ccgatcgagatcgccacgcgccaaggcaagatcgccttcgacaccgacgaatatgtccgc
accggcgcgaagcccggggattttgattcgcttcgtcccgtgttccagcgcgacggtggc
accgtcaccgccggcaacgcatcgggcataaatgacggtgccgccgccgtggtgctggcg
aacgacgtgtcggtgcgcgagctcggcctgacgccgttggggcgccttgtcgcttacggc
cacgccggcgttgaccctgcgtacatgggcatcggtcccgttcccgccacgcgcaatgcg
ctcgctcgtgccggcctcaagatagacgatctcgacatcatcgaggcgaatgaggcgttc
gcggctcaggcttgcgccgtcgcggcggaactcggccttgatcccgacaaggtaaacccc
aacggcagcggcattgcgctcgggcaccccgtcggggcaaccggcgccatcatcaccgcc
aagttgctttacgaattgcgccggacaaacaagcgttacggcctgaccacgatgtgcatc
ggaggcggccaaggcattgcggcgatatgggaacgagcctaa

DBGET integrated database retrieval system