KEGG   Sphingomonas panacis: AWL63_05380Help
Entry
AWL63_05380       CDS       T04760                                 

Definition
(GenBank) acetyl-CoA hydrolase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
span  Sphingomonas panacis
Pathway
span00020  Citrate cycle (TCA cycle)
span00620  Pyruvate metabolism
span00650  Butanoate metabolism
span01100  Metabolic pathways
span01110  Biosynthesis of secondary metabolites
span01120  Microbial metabolism in diverse environments
span01130  Biosynthesis of antibiotics
span01200  Carbon metabolism
Module
span_M00009  Citrate cycle (TCA cycle, Krebs cycle)
span_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:span00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AWL63_05380
   00620 Pyruvate metabolism
    AWL63_05380
   00650 Butanoate metabolism
    AWL63_05380
Enzymes [BR:span01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     AWL63_05380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF CoA_trans
Motif
Other DBs
NCBI-ProteinID: AOH86546
UniProt: A0A1B3ZGJ1
Position
complement(1229031..1230545)
Genome map
AA seq 504 aa AA seqDB search
MSDRIAHTGLRARITSAEQAATQIDHGMTVGMSGFTGSGYPKAVPMALAGRIEAEHAAGR
PMRVRVWTGASTGPELDGALARANGIELRLPYNSDPIARDRINRGEMDYLDMHLSQVAPM
AWQGFLGPLDVAIVEVSAIRADGSLVPSSSVGNNKTWLDRAEKVILEVNRWQNPALEGMH
DIYYGTALPPHRVPIPLVRPDDRIGELYLRCDPDKIVAIVETDSPDRNAPFSPPDAAAKA
IAEHLLDFLGHEVTKGRLPASLLPLQSGVGNIANAVLAGLVDGPFHDLTAYTEVIQDGML
DLLDSGRLRMASATAFSLSPEAAARLNAEMGRYRDRMILRPQEISNHPELIRRLGCIAMN
GLIEADIYGNVNSTCVMGSRIQNGIGGSGDFARNAYVSIFMTPSTAKGGKISAIVPQAAH
VDHIMQDVAVLVTEQGLADLRGLSPKHRARLVIEQCAHPSYRDALTDYYERALAGSYGLH
APSLPSEALSWHQRFIETGTMQPG
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaccggatcgcccacaccggattgcgcgcgcggatcaccagcgccgaacaggcc
gccacgcagatcgatcacggcatgaccgtcgggatgagcggcttcaccggctcgggttac
ccgaaggcggtgccgatggcgctcgccggccgaatcgaggccgagcacgccgcgggtcgc
ccaatgcgggtgcgggtgtggaccggcgcttcgaccgggccggagctcgacggcgcgctg
gcgcgtgccaatggcatcgaactgcggctaccctataattccgatccgatcgcgcgcgac
cgcatcaaccggggcgagatggactatctcgacatgcacctcagccaggtcgcgccgatg
gcgtggcagggattcctcgggccgctcgacgtcgcgatcgtcgaagtcagtgcgatccgg
gccgatggctcgctggtgccgtcctcctctgtcggcaacaacaagacctggctcgaccgc
gcggagaaggtgattctcgaggtcaatcgctggcagaacccggcgctggaggggatgcac
gacatctattacggcaccgcgctgccgccgcatcgcgtgccaattccgctcgtccgcccg
gatgaccgcatcggcgaactctatctgcgctgcgaccccgacaagatcgtcgcgatcgtc
gagaccgattcgccggatcgcaacgcgccgttctcgccgcccgacgccgcggcaaaggcg
atcgcggagcatctgctcgacttcctcggccatgaagtgacgaaggggcggctgccggcc
tcgttgctgccgctgcaatcgggcgtcggcaacatcgccaatgccgtgcttgccgggctg
gtcgacgggccgttccacgatctgaccgcctataccgaggtcatccaggacggcatgctc
gacctgctcgacagcggccggctgcggatggcgtcggcgaccgcgttttcgctcagcccc
gaggccgcggcccggctcaatgccgagatggggcgctatcgcgaccgtatgatcctgcgt
ccgcaggagatcagcaaccatcccgaactgatccgccggctcggctgcatcgcgatgaac
ggactgatcgaggccgatatctacggcaatgtcaattcgacctgcgtgatgggatcgcga
atccagaacggcatcggcggctcgggcgatttcgcgcgcaacgcttatgtctcgatcttc
atgaccccctccaccgctaagggcggcaagatctcggcgatcgtgccgcaggccgcgcat
gtcgatcacatcatgcaggacgtcgcggtgctggtgacggagcagggactcgccgatctc
cgcggcctcagccccaagcatcgtgcgcggctggtgatcgagcagtgcgcgcatccgtcc
taccgcgacgcgctgaccgactattacgagcgcgcgctggcagggtcatacgggctgcat
gcgccgtcgctgccaagcgaggcgctgtcgtggcaccagcgcttcatcgagacggggacg
atgcagccggggtga

DBGET integrated database retrieval system