KEGG   Sphingomonas panacis: AWL63_17215Help
Entry
AWL63_17215       CDS       T04760                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
span  Sphingomonas panacis
Brite
KEGG Orthology (KO) [BR:span00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    AWL63_17215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AOH86893
UniProt: A0A1B3ZHJ1
Position
complement(3829293..3829691)
Genome map
AA seq 132 aa AA seqDB search
MKSLFPHVAETRGVVVRVSVSYLPEQSEPARGRWFWAYHIRIENEGDQTIQLLTRHWVIT
DGRGARHTVEGEGVIGEQPLIAPGASYDYVSGCPLATPTGGMQGTYHMIGADGEGFDVEI
PKFALLAPAVGA
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcgctgttcccgcacgtcgccgagacgcgcggcgtggtggtgcgcgtgtcggtc
agctatttgcccgaacagtccgagcccgcgcgcgggcgctggttctgggcctatcatatc
cgcatcgagaatgagggcgaccagaccatccagttgctgacccgccactgggtcatcacc
gatggacgcggcgcgcgccatacggttgagggcgagggcgtgatcggcgaacagccgctg
atcgcgcccggcgcgagctacgattacgtctcgggctgcccgctcgccacgccgaccggg
gggatgcaggggacgtaccacatgatcggcgccgacggcgaagggttcgacgtggagatc
cccaaattcgcgctgctcgcgccggcggtgggggcgtga

DBGET integrated database retrieval system