KEGG   Saprolegnia parasitica: SPRG_00183Help
Entry
SPRG_00183        CDS       T04137                                 

Definition
(RefSeq) hypothetical protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
spar  Saprolegnia parasitica
Pathway
spar03040  Spliceosome
spar04141  Protein processing in endoplasmic reticulum
spar04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:spar00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    SPRG_00183
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    SPRG_00183
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    SPRG_00183
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:spar01009]
    SPRG_00183
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:spar03041]
    SPRG_00183
   03009 Ribosome biogenesis [BR:spar03009]
    SPRG_00183
   03110 Chaperones and folding catalysts [BR:spar03110]
    SPRG_00183
   04131 Membrane trafficking [BR:spar04131]
    SPRG_00183
   03051 Proteasome [BR:spar03051]
    SPRG_00183
   03029 Mitochondrial biogenesis [BR:spar03029]
    SPRG_00183
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spar04147]
    SPRG_00183
Protein phosphatases and associated proteins [BR:spar01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     SPRG_00183
Spliceosome [BR:spar03041]
 Complex B
  Other components
   Prp19 complex
    SPRG_00183
 Complex C
   Prp19-CDC5 complex
    SPRG_00183
Ribosome biogenesis [BR:spar03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    SPRG_00183
Chaperones and folding catalysts [BR:spar03110]
 Heat shock proteins
  HSP70 / DNAK
   SPRG_00183
Membrane trafficking [BR:spar04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    SPRG_00183
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    SPRG_00183
Proteasome [BR:spar03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    SPRG_00183
Mitochondrial biogenesis [BR:spar03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    SPRG_00183
Exosome [BR:spar04147]
 Exosomal proteins
  Proteins found in most exosomes
   SPRG_00183
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl Actin BcrAD_BadFG
Motif
Other DBs
NCBI-GeneID: 24122835
NCBI-ProteinID: XP_012193680
UniProt: A0A067CXA9
Position
Unknown
AA seq 609 aa AA seqDB search
MSSNTHCIAIDIGASTIRVGVWRNGRATVLALDGANGLPAVVAFTDTTTLFGNQAKAIAQ
NDPTNVVFNVLHLLGRRMNDPTVQAMVTSAPFRIIASSDKTPLIHVQHRRSACTYYPQEI
VGMLLEHAKKLAEDHLGACLDHAVVTVPATYTTSQRQAVLDAATMAGLTVDRLLSATTAV
GIAHTQATGASKRKLLVVDAGASSVTASVVTAEHDTFTAHASASDTQLGGFAMDARLAAH
CMSTWTPSTRGHDLILAKQRLLSACEAARCALSTSDETDVCIPHRSQDGMRLTLSREKLN
ALVHHLMDKVVAHVLKVLQQAQCCKEDVDDIVLVGGVALMPCLQTTLSNLFGGKQVAWFP
TPSEAVVAGAALYIASTTASSDATVRPFAIHDALSTPIWAAAAGHHWTTVFRSPALSSMA
THTFVSTGSSPFVLLVYEGDVGFPASSHLQGQWHIESLPHTRFIDVAFVVDECTGVLRVT
ASDKSSQKALPVTNTDCATSRRELQHLCAQATARYHTTRQTVLLARAKAAANDFTYSLRS
TWHSDEASRRRVGDAARDELDDALAAAIKWLLLHPQATIDQYDDVRVQLEAVSRRVLARA
AEPSWMLPE
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccaatacgcactgcatcgctatcgacattggcgcgtcgacgatccgcgtcggc
gtctggcgcaacggccgcgcgaccgttcttgcgctcgacggcgccaacgggctccccgcg
gtcgttgccttcacagacacgaccacgttgtttggaaaccaagccaaagccatcgcgcag
aacgatcccacgaacgtcgttttcaacgtcttgcatcttcttggtcgccgcatgaacgac
ccgacggtccaagccatggtaacgagcgcgccattccgaatcatagcgtcgtcggacaag
acgccgctgatccatgtgcagcaccgaagaagcgcgtgtacgtactacccacaagagatc
gtcggcatgctcctcgagcacgccaagaagctggccgaagaccacctcggcgcgtgtctc
gaccacgcagtcgtgactgtgcccgcaacatacacgaccagtcagcgtcaagccgttttg
gatgcggcgacgatggctgggctgactgtcgatcggctcttgagcgccacgacggctgta
ggtattgcccatacgcaagccaccggcgccagtaagcgcaaattactggtggttgacgcg
ggggcgagctcggtcacagcctcggtcgtgactgcagagcacgatacgtttacggctcac
gcatcggcaagtgatacgcagctcggcggcttcgccatggacgcccgccttgcagcgcac
tgtatgtctacgtggacgccctcgacgcgaggacacgatctcatcttggctaagcaacgc
ctcctttccgcatgcgaagccgcgcgctgtgccctctcgacgagcgacgagacggacgtg
tgcatcccgcaccgaagccaagacgggatgcgtctcactctctcgcgcgaaaagctcaac
gctttggtccaccatctcatggacaaagttgtcgctcatgttctcaaagtcctccagcaa
gcgcagtgctgcaaggaagatgtggacgacattgtcctcgtcggcggcgtcgcgttaatg
ccgtgcctgcaaactacgctctcaaacttgtttggtggcaaacaagtcgcgtggtttcca
acgccgagcgaagcggtggtcgccggcgcagcgctctacatcgccagtacgacggcgtcg
agcgacgctactgtccgaccctttgcgatccatgacgcgctctcaactccgatctgggct
gccgccgccggccaccactggacaaccgtgttccggtcccccgcgctttctagcatggct
acccacacgttcgtatcgactggtagcagcccctttgtcttgcttgtgtacgagggcgac
gtcggttttcctgcgtcgagccatctccagggccaatggcacattgagtccttgcctcac
acccggttcatcgacgtggcatttgtcgtcgacgaatgcacgggcgttctccgcgtcacc
gccagcgacaagagctcgcaaaaggcccttccagtgaccaacacggactgtgccacgtca
cgacgagagctgcagcacctgtgcgcacaagcgacggcgcggtaccacacgacgcgacag
acggtccttctggcgcgtgccaaggctgctgccaatgactttacctattcgcttcgcagt
acgtggcacagcgacgaagcctctcgccgccgcgtcggagacgcagcgagagacgagctg
gacgacgcgctcgcagccgccatcaagtggcttcttctgcacccacaggcgactatcgac
cagtacgacgatgtccgcgtccagctggaggccgtgagccgccgcgtgctggcgcgggcc
gccgagccttcgtggatgctgcccgagtag

DBGET integrated database retrieval system