KEGG   Saprolegnia parasitica: SPRG_01084Help
Entry
SPRG_01084        CDS       T04137                                 

Definition
(RefSeq) hypothetical protein
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
spar  Saprolegnia parasitica
Pathway
spar00010  Glycolysis / Gluconeogenesis
spar00562  Inositol phosphate metabolism
spar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPRG_01084
   00562 Inositol phosphate metabolism
    SPRG_01084
Enzymes [BR:spar01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     SPRG_01084
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     SPRG_01084
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF5375
Motif
Other DBs
NCBI-GeneID: 24123694
NCBI-ProteinID: XP_012194673
UniProt: A0A067D0I2
Position
Unknown
AA seq 422 aa AA seqDB search
MRIVLLATAALAVRHVPIDDFELTQRLATKTPYYSQAEPFEIDAPAGCTPVQVNMVVRHG
TRFPTAKVIKKIASVAAKLQSQASSVPEWLHAYDVEHEFPLAREAELAPAGVDELVGLGD
RVRQKFGLAFQASYDEAAYVFEHTWKTRTAQSAQAFAHGFFRGDDAAVVYQVAPKGRDVE
LRFFDNCPQFTAAVDDNSTAWSEYASFPTSPSMQANVDEFRSTLQMPSLTASDLDAAYEA
CAFDVAVHHRQDRWCSLFGVDLLASMEYFKDLKAYYKKSYGNPLAYEIAAPLLSSMLAGM
ADVRDGKDQREGHFRFAHAETILPLSSLLGYKKGDRPLQAAALQPQRHFKSAVVSPFGAN
IAFVLYACGNNAADHVVQLQINEKQLPIPGLACIFCPLAQLEAHFARYTAMDFDHICQLR
NE
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcgtcctgctggcgacggcggcgctggccgtgcgccacgtgcccatcgacgac
tttgaactgacgcagcgactcgcgaccaagacgccgtactactcgcaggccgagccgttc
gagatcgacgcgcccgctggctgcacgcctgtccaggtcaacatggtcgtgcgccatggc
acacggttccccacggccaaggtcatcaagaagatcgcgtcagttgccgccaagctccag
tcgcaggcgtcatctgtgccagaatggctccatgcatacgacgtcgagcacgagtttccg
ttggcgcgcgaagccgagctcgcgccggccggtgtcgacgagctcgtcggtctcggcgat
cgcgtgcggcaaaagtttggtcttgcgttccaagccagctacgacgaggcggcctatgtg
tttgagcacacgtggaagacacggacggcgcaaagcgcccaggcgtttgcgcacggcttc
ttccgaggcgacgacgccgccgttgtgtaccaagtggccccaaaaggccgcgatgtggag
ctccgcttcttcgacaactgtccgcagtttacggcagccgtcgacgacaacagcacggcg
tggtccgagtacgcatcgtttccgacatcgccgtcgatgcaagccaacgtcgacgagttc
cgctcgacgctgcagatgccgtcgctgacggcgagcgacctcgatgctgcctacgaagct
tgcgcgtttgacgttgcagtgcaccatcgtcaagaccggtggtgcagcctctttggcgtc
gacctcttggcgtccatggagtacttcaaggacttgaaagcgtattacaagaagagctac
ggcaaccctctcgcctacgagattgctgcgccgctcttgtcgagcatgctcgcgggcatg
gccgacgtgcgcgacgggaaagaccaacgcgaaggccactttcggtttgcccacgccgag
acgatcttgccgctgagcagtctcttgggctacaagaagggcgatcggccgctccaagca
gcagcgttgcagccccagcgccacttcaagagcgcggtcgtgtcgccgttcggcgccaac
atcgctttcgtcctctacgcgtgcgggaacaacgccgccgaccacgtcgtccagctgcaa
atcaacgaaaagcagctgccgataccggggctcgcctgcatcttttgtccgctcgcgcag
ctcgaagcccattttgcccgctacacggccatggactttgaccacatctgccagttgcgc
aacgaataa

DBGET integrated database retrieval system