KEGG   Saprolegnia parasitica: SPRG_01554Help
Entry
SPRG_01554        CDS       T04137                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase H
  KO
K09567  peptidyl-prolyl isomerase H (cyclophilin H) [EC:5.2.1.8]
Organism
spar  Saprolegnia parasitica
Pathway
spar03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:spar00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    SPRG_01554
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:spar03041]
    SPRG_01554
   03110 Chaperones and folding catalysts [BR:spar03110]
    SPRG_01554
Enzymes [BR:spar01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     SPRG_01554
Spliceosome [BR:spar03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6 snRNP specific factors
    SPRG_01554
Chaperones and folding catalysts [BR:spar03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    SPRG_01554
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 24124136
NCBI-ProteinID: XP_012195150
UniProt: A0A067CUM4
Position
Unknown
AA seq 182 aa AA seqDB search
MDPALSEAVRRGNPVVFFDVALGNAPLGRIKMELFKRECPKTVENFRQFCTGEYRRGDMP
TGYKGSHFHRVIPDFMIQGGDFLKGDGTGRMSIYGDKFADESFAYKHTEPGLLSMANSGV
DTNGCQFFITCAPCDWLDGKHVVFGKLLDPASLLVMRKIESVQTGAANKPKTPVTITECG
EL
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggacccggcgctgagcgaagccgtccggcgtggcaaccccgtcgtcttcttcgacgtc
gcgctgggcaacgcgcccttgggccgcatcaagatggagctcttcaagcgcgagtgcccc
aagacggtcgagaactttcgccagttctgcacgggcgagtaccgccgcggcgacatgccc
acgggctacaagggcagccattttcatcgcgtcattcccgactttatgatccaaggcggc
gacttcctcaagggcgatggcacgggccgcatgagtatttatggcgacaagtttgccgat
gaaagctttgcgtacaagcacacggagcccggtctgctctcaatggccaacagcggcgtg
gacacgaacggctgccagttcttcatcacgtgtgcgccctgcgactggctcgacggcaag
cacgtggtctttgggaagctcctggacccggcctcgctcctcgtgatgcgcaagatcgag
agcgttcagaccggcgctgcgaacaagcccaagacgcccgtgacgatcaccgagtgcggc
gagttgtag

DBGET integrated database retrieval system