KEGG   Saprolegnia parasitica: SPRG_02382Help
Entry
SPRG_02382        CDS       T04137                                 

Definition
(RefSeq) hypothetical protein
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
spar  Saprolegnia parasitica
Brite
KEGG Orthology (KO) [BR:spar00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:spar01002]
    SPRG_02382
Enzymes [BR:spar01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     SPRG_02382
Peptidases and inhibitors [BR:spar01002]
 Metallo peptidases
  Family M16: pitrilysin family
   SPRG_02382
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16 Peptidase_M16_C
Motif
Other DBs
NCBI-GeneID: 24124937
NCBI-ProteinID: XP_012196348
UniProt: A0A067D104
Position
Unknown
AA seq 982 aa AA seqDB search
MESSVKSQGGIDVSAADERDYRHIELPNGLCALLVSDNDAEKSAAAMDVRVGHQSDPDDL
LGLAHFLEHMLFMGTEKYPDENSYSQYLSSHGGSSNAYTSGTDTNYYFDVRPAYFHEALD
RFAQFFISPLFTPGATEREMNAVNSENNKNLQNDAWRLDQVVKHTSNPKHPYHKFGTGNL
VTLGTRAKEDVRAELMAFHATYYSARIMKLAVVAKEDLDTLESWVRALFSPIADTGTKVF
KYDGVPFETPQLQRRLRVMPVKDLRTIEVAWPLPPMRHAYLEKPTSILSHLLGHEGPGSL
LSYLKGQKWVNELSAGLMKDHDDWSLFCVEVEATDAGIAHTDDIVFAIYQYLALLTSSPI
ERWVFDEAKNIALMNFRFRSKETPMHYATSLATKMQTFPVQHIVAGSYLLYDFNPTKVHD
VLRLLSPARMRLTVVSKTFANSTPLVEPWYESHYSNDALDPALVRRWSAPTPNAAFVLPH
PNAFIPKNFELVSTPTQSPTPVLLRDDALGRLWVKTDTTFLKPKLNICMTLQSPMIYVSP
TTAVLTDMFVRAVKDKLTEITYDAELAGMRYSMSFSSKALELYGGGYSDKLPALLTAIVQ
TMTSIVIDDETFTRIYDKTKRSYDNFEREDPYKHALYFSTCVLEATKWTVAEKAAAIAHV
TTDDLRHHATTLFRQAYVESYFHGNVDAASAVVWLDAILAPMHARPLVSAQRQKIRAVQL
SRGHDVVFAVPELNPESVNSGVHTMFQLGLESTRLRALNEVFAQLAKEPCFNQLRTIEQL
GYIVFSSTHRAHGVEYYRLIVQSDVAPPAYVEASIDAFLLSMRAAILNLSATEFEKNLNA
VVDTLLEKPKTASEECSRFWEEISAETYSFSRRVDVAAAVKTLIVADVVAFLDECILGEF
RVKFSVHMLGKHHVVELPAVTTTPPFAATDLTATVASFVLDQSLTPGRRTHVIHDINRFK
HNLPLFPERPSAHVCVHAISEP
NT seq 2949 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtagcgtcaagagccagggaggtatcgacgtgtcagccgccgacgagcgcgac
taccgtcacattgagcttccgaacggcctctgcgctctgctagtctcggacaacgatgcg
gaaaagtcggctgcggccatggatgtacgcgttgggcatcagagcgacccggacgacctc
ttgggcctcgcccattttctcgagcacatgctctttatgggcacggagaagtatccggac
gagaactcgtactcccagtatctgagctcgcacggtggcagctcgaatgcgtacacgagt
ggcacagacaccaactactactttgacgtgcgacctgcgtacttccacgaggctctcgac
cgctttgcgcagttctttatctcgccactcttcacgcccggcgccacggagcgcgagatg
aacgcggtcaactcggagaacaacaagaacctacagaacgacgcgtggcgtctcgatcaa
gtcgtcaagcatacgagcaacccaaagcacccgtaccacaagttcggtaccggcaatctt
gtcacacttggcacgcgtgcgaaggaagatgtacgcgctgagctcatggcgttccacgct
acctactactcagcacgtatcatgaagctcgcggtcgtcgccaaggaagacctcgacacg
cttgagagctgggtgcgcgcgctctttagccctatcgcagacacgggcaccaaggtgttc
aagtacgacggtgtaccgttcgagacgcctcagcttcagcgccgtctgcgcgtgatgcct
gtcaaggacctccgcacgatcgaagttgcgtggccgttgccgccaatgcgccacgcgtac
ttggagaaaccgacgagcattctctcgcacctccttggtcatgaaggaccaggttcgctt
ctgtcgtacctcaaaggtcaaaaatgggtcaacgagctctccgcgggtctcatgaaggac
cacgacgactggtcgctcttctgcgtcgaggtcgaggcgacggacgcaggcattgcgcac
actgacgacattgtatttgcgatctaccagtacctcgcgttgctgacgtcgtcgccgatc
gagcgctgggtctttgatgaggccaagaacattgcgctcatgaactttcggtttcggagc
aaggagacgccgatgcactacgcaacttcactcgctaccaagatgcagacctttccggtc
cagcacatcgtcgccgggagctatctcttgtacgactttaacccgacgaaggttcacgac
gtgctccgccttctctcgcctgcgcggatgcgcctcacggtcgtgagcaagacatttgcc
aactcgacgccgcttgtcgagccgtggtacgaatcgcactacagcaatgacgcgctggat
ccggcgctcgtgcgccgctggtctgcaccgacgcccaacgcggcgttcgtccttccgcac
ccgaacgcgttcatcccaaagaactttgaactggtttcgacgccgacccagtcgccgacg
ccggttctcttgcgcgacgatgcgctcgggcgtctctgggtcaagacagacacgacgttc
ctcaagccgaagctcaacatttgcatgacgctgcagtcgccgatgatttacgtgtcgcca
acgaccgccgttctcaccgacatgtttgtgcgtgccgtcaaagacaagctgaccgaaatt
acttacgacgccgagctcgcgggcatgcgttactcaatgtcgtttagctccaaggcgctg
gagctctacggtggcggctacagcgacaaactcccggcgctcttgacagccatcgtgcag
acaatgacgagcatcgtgattgacgacgagacctttacgcgcatctacgacaagacgaag
cgcagttacgacaactttgagcgcgaagatccgtacaagcacgcgctctactttagcacg
tgtgtgctcgaggcaacgaagtggacggtcgcggagaaggccgcagccatcgcccacgtt
accacggacgatttgcgccatcacgcaacgacactcttccgccaagcgtacgttgagagc
tacttccacggtaacgtcgacgctgcatcagcggtcgtttggctcgacgctatccttgcg
cccatgcatgctcgcccgctcgtatcggcgcaacgccaaaagatccgcgctgtgcagctc
agccgcggccatgacgtcgtctttgctgtcccggagctgaatccggagagcgtcaactcg
ggcgtacacaccatgttccagctcgggctcgagtcgacgcgtctccgtgcgctgaacgag
gtctttgcgcagcttgccaaagagccttgcttcaaccaattgcgcacgatcgagcagctc
ggctacatcgtcttctcgagtacccaccgcgcgcacggtgtcgagtactaccggctcatc
gtgcaatccgacgtcgcgccgcccgcgtacgttgaagccagcattgacgcgttcttgctt
tcgatgcgcgctgctattctgaacctttcggcgaccgagtttgaaaagaacctgaacgct
gtcgtcgacacgcttctagaaaagcccaagaccgcgtccgaagagtgctctcgcttctgg
gaggaaatctctgccgagacatacagcttctcgcgccgcgtggacgtggcggcggccgtc
aagaccctcatcgtcgccgatgtcgtcgccttcttggacgagtgcatccttggcgagttt
cgcgtcaagtttagcgtacacatgcttgggaagcatcatgtcgttgagctgcctgctgtg
acgacgacaccaccgtttgctgcgacagaccttacggccaccgtcgcgtctttcgtgctt
gatcagtccttgaccccagggcgccgtacgcatgtgatccacgacatcaaccgcttcaag
cacaacctccctctcttcccggagcgcccgtcggcgcacgtctgcgtccacgccatctcg
gaaccttga

DBGET integrated database retrieval system