KEGG   Saprolegnia parasitica: SPRG_03246Help
Entry
SPRG_03246        CDS       T04137                                 

Definition
(RefSeq) hypothetical protein
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
spar  Saprolegnia parasitica
Pathway
spar00350  Tyrosine metabolism
spar00360  Phenylalanine metabolism
spar00380  Tryptophan metabolism
spar01100  Metabolic pathways
spar01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spar00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    SPRG_03246
   00360 Phenylalanine metabolism
    SPRG_03246
   00380 Tryptophan metabolism
    SPRG_03246
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spar04147]
    SPRG_03246
Enzymes [BR:spar01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     SPRG_03246
    4.1.1.105  L-tryptophan decarboxylase
     SPRG_03246
Exosome [BR:spar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SPRG_03246
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2 Spore_YhcN_YlaJ
Motif
Other DBs
NCBI-GeneID: 24125765
NCBI-ProteinID: XP_012197219
UniProt: A0A067CMV7
Position
Unknown
AA seq 512 aa AA seqDB search
MLSSTARRLARPSLLARASSHAANSLPPAPADYDWDAFRAKAHQTIDFIVDYNKRLAARE
LPVLPSCEPGDVRRALPSRPSETPVEWSQILADVEKVVVPNMTHWQHPDFMAYFPAQAAP
SAMLGELMANAMNQPGFNWICSPAATEMELHVMDWLREAFGLPEAMSWRGSGGGIMQPSA
TEGMIVAQVSARTRKLAANPGLSLDSLVSYYSDQSHFCVEKASKVLGVKHLRKIPSVLDP
STGNYAMDLTVLAATIADDKANGLAPFFVSGNYGATGVCAIDDIEAMATIASEHDMWLNM
DAAYAGVVALLPEMRSTLGGMHVCDSLLMNGSKWFHLMFNSSFFFFRQKEHVVQALNATG
AYLENKHTAENNVFDLKDYQLGLGRPFRGLKAYCTIQSMGLEGFRDGLRRHLQLATYLAD
ELRQHDSIHVLRDVFGLVCFRVKDADDATNMAVMERLNNVEGIHMVHTVTADHGVVLRLA
LCHPQLTVDDMDRLVAKVLRSLPDAQDVAIVA
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgctgagctccaccgcccgccgcctcgcccgcccgtcgctgctggcgcgtgccagcagc
catgctgccaacagtcttccgccggcccccgccgactatgactgggatgccttccgggcc
aaggcccaccaaaccatcgatttcatcgtcgactacaacaagcggctggcggcacgcgag
ctgcccgtgctgccgtcgtgcgagcctggcgacgtgcgtcgcgcgctgccgtcacgcccg
tccgagacgcccgtcgagtggtcgcagatcttagccgacgtcgagaaggtcgtcgttccc
aacatgacgcattggcagcacccggactttatggcgtactttcccgcccaagccgcgccg
tcggcgatgctcggcgagctcatggccaacgccatgaaccagccgggcttcaactggatc
tgctcgcccgcggcaacagagatggagctccacgttatggactggctccgcgaagctttc
ggcttgccagaggccatgtcgtggcgcggctcgggcggtggcatcatgcaaccgagcgcg
accgaaggcatgatcgtcgctcaagtctcggcccgcacgcgcaagctcgctgccaacccg
ggtctatccctcgacagcctcgtgagctactacagcgaccagtcccatttctgtgtcgag
aaggcgagcaaagtcctcggtgtcaagcatttgcgcaaaattccatcggttttggacccg
tcgaccggcaactacgccatggacctcacggtgctcgcggcgacgatcgcagacgacaag
gccaatggcctcgcgccgttcttcgtctcgggcaactatggggcgaccggtgtttgcgcg
atcgacgatattgaagccatggccaccatcgcttcggagcacgacatgtggctcaacatg
gacgccgcgtacgctggcgtggtcgcgctcttgcccgagatgcggtcgacgctcggcggc
atgcacgtctgcgactcgctcctcatgaacggctcgaaatggttccacctcatgttcaac
tcgagcttctttttctttcgtcaaaaggagcatgtcgtccaagcactcaacgcgactggc
gcgtacctcgagaacaagcacacggccgagaacaacgtctttgacctcaaggactaccag
ctcggtcttggccggccgttccgcggcttgaaggcgtactgcacgatccaaagcatgggt
ctcgaaggcttccgcgacgggttgcgccgccatttgcagctggcgacgtatctcgccgac
gagctgcgccagcacgactcgatccacgtgctccgagatgtctttggcctcgtttgcttc
cgcgtcaaggacgctgacgatgcgaccaatatggcggtcatggagcgcctcaacaacgtc
gagggcatccatatggtccatacggtcacggccgaccacggcgttgtcctccgcctcgcg
ctctgccacccgcagctcacggtcgacgacatggaccgcctcgtggccaaggtgctgcgg
tcgctgcccgatgcacaggacgtggcgatcgtcgcctaa

DBGET integrated database retrieval system