KEGG   Saprolegnia parasitica: SPRG_03538Help
Entry
SPRG_03538        CDS       T04137                                 

Definition
(RefSeq) hypothetical protein
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
spar  Saprolegnia parasitica
Pathway
spar00511  Other glycan degradation
spar00600  Sphingolipid metabolism
spar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spar00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    SPRG_03538
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SPRG_03538
Enzymes [BR:spar01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     SPRG_03538
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Ricin_B_lectin Glyco_hydro_30C RicinB_lectin_2 Glyco_hydro_59 DNA_pol3_a_NII
Motif
Other DBs
NCBI-GeneID: 24126032
NCBI-ProteinID: XP_012197508
UniProt: A0A067CM85
Position
Unknown
AA seq 672 aa AA seqDB search
MTNASLASSSTNSQYGSVPASMAKMYAAEGRSKKLWAGAVMAATMVAAGVVMTTGASDSP
IVIATLEDSTPTIVEDNSLLVVESAFEAEQLFRPVEHKGLTKQKKSKKTNVASTIHVDDT
QVKQEILGFGGAFTEAAAIQFKKLSPELQEEVLRLYFDKETGAGYTIGRVPMNSCDYSPG
SYSFDDVVGDVTLSHFDMNVTHDHDTMIPFIQAALAKRPDMKLFLSPWSPPAWMKLPDGK
GKQTMTGSVQPVGLDPKYRSAWALYFSKFITAYQGQNISFWGLTPQNEPMFAAPWEACSY
DAQAEAAFVADYLGPQIRQDHPDVKIMVFDHNRDAVTQWAQAAYNKAAEYVDGVAVHWYN
GGGRELDGVLFHTHLNDTHHLNPDKFILATESCNCPNVATGKDAWFRAQRYAHDILGDLN
NWAVGWVDWNLMLDHTGGPNHLGNTCDAPIIMNPAGDNFALQPMYHFIKHFSHFAPPGSK
RIASDIRVEYAAPGIPDLYTQYPAAAHHCDKSSRQSLYKTQDSKIKVTDNDFCIDVVHEW
FGNKIELVKCIYTSNRWTFADDGSIRFRGQCLATAHGSLESGAALTLEQCVDADHQKWTF
SNTQLVNKATGLCATAGYAFTQAIAFKTPEDKKVLVVLNENSEDATFTITTNDGRQVATV
VPKGAIRTYQWA
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacgcatcgctcgcgtcgtcgtcgaccaactcgcagtacggatcggtgcccgcg
tcgatggccaagatgtacgctgcggaaggccgcagcaagaagctgtgggctggcgcggtg
atggctgccaccatggtggcggccggcgtcgtcatgacgaccggcgcctcggactcgcct
atcgtcatcgccaccctcgaagacagtacgccgaccatcgttgaagacaacagcttgctc
gtcgtcgagtcggcctttgaggcggagcagctcttccgccccgtcgagcacaagggtctc
accaagcagaaaaagtccaagaagaccaacgttgccagcaccatccacgtcgacgacacc
caggtcaagcaagagatcctcggctttggcggtgccttcacggaggcggccgcgatccag
ttcaagaagctgtcgccagagctccaagaagaagttttgcgcctctactttgacaaggag
actggcgctggctacacgattgggcgtgtgcccatgaactcgtgcgactactcgccggga
tcgtactcgttcgacgatgtcgtcggtgatgtgaccttgtcgcacttcgacatgaacgtg
acgcacgaccacgatacgatgatcccattcatccaggccgcgctcgccaagcgcccggac
atgaagctcttcctctcgccgtggagcccgcccgcgtggatgaagctgccggacggaaag
ggcaagcaaaccatgacgggctccgtccaacccgtgggcctggaccccaagtaccgctcg
gcgtgggcgctctacttttccaagttcattacggcgtaccagggccagaacatctcgttc
tggggcctcacgccgcagaacgagccgatgttcgcggcgccgtgggaagcgtgctcgtac
gacgcgcaggccgaagccgcgttcgttgccgactacctcggcccgcagatccggcaggac
cacccggacgtcaagatcatggtcttcgaccacaaccgcgacgccgtgacgcagtgggcg
caggccgcgtacaacaaggccgccgagtacgtcgacggtgtcgccgtccactggtacaac
ggcggtggtcgtgagctcgacggtgtcctcttccatacgcacctcaacgacacgcaccat
ttgaacccagacaagttcatcctcgcgaccgagagctgcaactgcccgaacgtcgctacg
ggcaaagacgcgtggttccgtgcgcagcgctacgcgcacgacatcctcggcgacctcaac
aactgggccgtcggctgggtcgactggaacctcatgctcgatcacacgggcggccccaac
cacctcggcaacacgtgcgacgcgccgatcattatgaacccggctggcgacaactttgcg
ctgcagcccatgtaccacttcatcaagcacttttcgcactttgcgccgccgggctccaag
cgcattgcgtccgacatccgcgtcgagtacgcggcgccgggtattcctgacctctacacg
cagtacccggcggcggcgcaccactgcgacaagtcgagccgtcagtcgctctacaagacg
caggactccaagatcaaggtcacggacaacgacttttgcatcgacgtggtgcacgagtgg
tttggcaacaagatcgagctcgtcaagtgcatctacacgtccaaccgctggacgtttgcg
gacgacggctcgatccgctttcgcggccagtgcctcgcgaccgcccacggctcgctcgag
tcgggcgccgcgctcacgctcgagcagtgcgtggacgcggaccatcaaaagtggaccttc
tccaacacgcagcttgtcaacaaggccacggggctctgtgcgacggcgggctacgcgttt
acgcaagcgattgcgttcaagacgcccgaggacaagaaggtactcgtcgtcctcaacgaa
aactcggaagacgctacgttcacgatcacgaccaacgatggccggcaagtggcgaccgtc
gtgcccaagggcgcgatccggacgtaccagtgggcgtaa

DBGET integrated database retrieval system