KEGG   Saprolegnia parasitica: SPRG_06894Help
Entry
SPRG_06894        CDS       T04137                                 

Definition
(RefSeq) hypothetical protein
  KO
K00804  geranylgeranyl diphosphate synthase, type III [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
spar  Saprolegnia parasitica
Pathway
spar00900  Terpenoid backbone biosynthesis
spar01100  Metabolic pathways
spar01110  Biosynthesis of secondary metabolites
spar01130  Biosynthesis of antibiotics
Module
spar_M00367  C10-C20 isoprenoid biosynthesis, non-plant eukaryotes
Brite
KEGG Orthology (KO) [BR:spar00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SPRG_06894
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:spar01006]
    SPRG_06894
Enzymes [BR:spar01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     SPRG_06894
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     SPRG_06894
    2.5.1.29  geranylgeranyl diphosphate synthase
     SPRG_06894
Prenyltransferases [BR:spar01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   SPRG_06894
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: polyprenyl_synt DUF3263
Motif
Other DBs
NCBI-GeneID: 24129212
NCBI-ProteinID: XP_012201746
UniProt: A0A067CA41
Position
Unknown
AA seq 295 aa AA seqDB search
MADDDHSLLEPWYYIRAMPGKNIRAIMVDAFQLWLAIPDDKVAAIKDIVGTLHDASLLID
DIEDNSELRRGQPVAHAIFGIPSTINCANFAFFLALERCNALGSPRAMELYIREMINLHR
GQGQDILWRDTASCPTEDAYKAMVINKTGGLFRLAVGLMQAFSDCTSDFIPLVNSLGLYF
QIRDDYINLVDTDYMEHKSYCEDLTEGKFSFPLLYGIQKDPSDHRLLSILKQRTTNRSVK
EHAVKYLAETGAFEYTKAYLEALYTEILSEIAALGGNPMLVGLVQKLHATLTSAS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgacgaccatagccttctggagccatggtactacatccgcgcgatgcccggc
aagaacatccgggccatcatggtcgacgcgttccagctctggctcgcgattccggacgac
aaggtggcggcgatcaaggacattgtgggcacgctccacgacgcgagcttgctcatcgac
gacattgaagacaactcggagctccggcgcgggcagccggtggcgcatgccatctttggg
attccgtcgacgatcaactgcgccaactttgccttcttcctcgcgctcgagcgctgcaac
gcgctcgggagcccgcgtgcgatggagctgtacattcgcgaaatgatcaacctccaccgc
ggccaaggccaggacattttgtggcgtgacacggcatcgtgcccgaccgaagacgcgtac
aaagccatggtcatcaacaagacaggcggcctcttccgcctcgccgtcggtctcatgcaa
gcgtttagcgactgcacctcggactttattccgctcgtcaactcgcttggcctgtatttc
cagatccgcgacgactatatcaacctcgtcgacaccgattacatggagcacaagagctac
tgcgaagacttgaccgaaggcaagttttcctttccgctgctctatgggatccagaaggac
ccgagcgaccaccggctcctgagcatcctcaagcaacgcacgaccaaccgcagcgtgaag
gagcacgctgtcaagtacctcgccgagacgggcgcgttcgagtacacaaaggcgtatctc
gaggcgttgtacaccgagatcctcagcgaaattgctgctttgggcggcaatccgatgctc
gttggccttgtccagaagctccacgcgacactgacctcggcctcgtag

DBGET integrated database retrieval system