KEGG   Saprolegnia parasitica: SPRG_08578Help
Entry
SPRG_08578        CDS       T04137                                 

Definition
(RefSeq) hypothetical protein
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
spar  Saprolegnia parasitica
Pathway
spar03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:spar00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    SPRG_08578
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:spar03041]
    SPRG_08578
Enzymes [BR:spar01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     SPRG_08578
Spliceosome [BR:spar03041]
 Complex C
  Other components
   Step II factors
    SPRG_08578
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C S1 AAA_22 DEAD AAA_19 T2SSE AAA_30 AAA_14 SRP54 PhoH DUF2075 AAA_7
Motif
Other DBs
NCBI-GeneID: 24130792
NCBI-ProteinID: XP_012203208
UniProt: A0A067CI70
Position
Unknown
AA seq 1091 aa AA seqDB search
MEKLQELSLISKVCSELESHLGMSERTLAEFIIDLARSSKDGKAFYAELSANGAEFPMTF
ALHLYQLVRTMTKKPAKKPILPTSDAPFPGLARPNSKPINDEALDVQDIAGLGDADRAPP
ASSRRDKSRSRSRDRYRKRSRSRSRDRRDRRRSRERERPVELHEIYNGRVSKLMDFGIFV
ELEGVRGTKEGLVHVRNISDARITHPKEVVRRGDRVKVKAISVSGKLMLSMRDVDQKTGR
DLMPMRATSGVDNRTDSKSWVNPTAPGMQEIDRDEYENTSRARAVQRMSSPERFEARQLI
NAGVLSVSEYPTFDDDHGLLNMEETEEEFEVELNEDEPTFLRGQTKAALEMSPVRIVKNP
DGSLSRAAMQQSSLAKERRELRQTQQNELLDSIPKDLNRPWEDPMPEAGERHFATELRGI
NMGSSFELPEWKSKAQGKNLSYGHVSAKSMIEQRESLPVFKLKGQLMQAIRDNQILVVIG
ETGSGKTTQMTQYMAEMGLTSRGMIGCTQPRRVAASSVAKRVAEEFGCALGQEVGYAVLI
KYMTEGMLMREYLADATLSRYSALILDEAHERTINTDVLFGLLKALVKKRPELKIIVTSA
TLDAEKFSHYFYDCPIFTIPGRTFPVEILYTKEPEADYLDAALITVMQIHLSEPEGDILV
FLTGQEEIDTACEVLYQRIKSLGALAPELIILPVYGALPSEMQTRIFEPAPKGSRKCVVA
TNIAEASLTIDGVYYVVDPGFQKEKAFNAKIGMDSLIVVPCSQASARQRAGRAGRTGPGK
CYRLYTEAAYKNEMLPTAIPEIQRTNLGTIVLQLKAMGINDLMGFAFLDPPPVPALIAAM
ENLYALGALDDEGLLTRLGKKMSEFPVEPKDAKVLLTSVVLGCSDEVLTIISMLAVENVF
FRPKEKQAQADSKKAKFNQPEGDQLTLLAVYEAWKHSKFSNPWCFENFIQARAIRRALDV
RKQLLSTMDRFKMDVVSAGKNYNKIRRAIVSGYFANSAKKDPQEGYRTMVEGQPVYIHPS
SSLFNKNPEWVIYQELVLTTKEYMRNVMAIDPKWLKGDPTKMTKQKKAQKIEPLHDRFNP
KDSWRLSQRRG
NT seq 3276 nt NT seq  +upstreamnt  +downstreamnt
atggagaagctgcaggagctgagcttgatctccaaggtatgttcggagctcgagagtcac
ctgggcatgagtgagcgtacgctggcagagttcatcatcgacctcgcccgcagctccaag
gatggcaaggccttctacgccgagctctcggccaacggcgccgagttccccatgaccttt
gccttgcacctctaccagctcgtccgcacgatgaccaagaagccggccaagaagccaatc
ttgccgacgagcgacgcgccgtttcccggcctcgcgcggcccaactcgaagcccatcaac
gacgaggcgctcgacgtacaagacattgccggccttggcgacgccgaccgcgcgccgccg
gcctcgtctcgccgcgacaagagccggtctcggtcgcgcgatcggtaccgcaagcgcagc
cgcagtcgtagccgagaccgtcgggaccgccgtcggtcgcgcgagcgcgagcgcccagtc
gagctgcacgagatttacaacggccgggtctccaagctcatggactttggcatctttgtc
gagctggaaggcgtgcgcgggacgaaggaaggtcttgtccacgtgcgcaacattagcgac
gcgcgcattacgcacccgaaggaagtcgtccggcgcggtgaccgcgtcaaggtcaaggcc
atctcggtctcgggcaagctcatgctctcaatgcgcgacgtcgaccaaaagacaggtcgc
gacctcatgcccatgcgggccacctcgggcgtcgacaaccggaccgactccaagtcgtgg
gtcaacccgacggcgcccggcatgcaagaaattgaccgcgacgagtacgagaacacgagc
cgcgcgcgcgccgtccagcgcatgtcgtcgcccgagcgctttgaggcgcggcagctcatc
aacgccggcgtgctctccgtgtccgagtacccgaccttcgacgacgaccacggcttgctc
aacatggaggagaccgaagaggagtttgaggtcgagctcaacgaagacgagccgacgttc
ttgcgagggcagacgaaagcggcgctcgagatgtcgccggtccgcatcgtcaagaacccg
gacggatcgctctctcgtgcggcgatgcagcagtcgtcgctcgccaaggagcgccgcgag
ctccgccaaacgcagcagaacgagctcctcgactcgatcccaaaggaccttaaccgcccg
tgggaagatccgatgcccgaagccggcgagcgccactttgcgaccgagctccgcggtatc
aacatgggttcgtcctttgagttgcccgagtggaagagcaaggcgcaaggcaagaacctc
agctacggccacgtctcggccaagagcatgatcgagcagcgcgagagtctccccgtcttc
aagcttaagggccagctcatgcaagcgatccgcgacaaccagattctggtcgtcattggc
gagaccggcagcggcaagacgacgcagatgacgcagtacatggccgagatgggtctcacg
tcgcgcggtatgattggctgcacgcagccgcgccgtgtcgcggcgtccagcgtcgccaag
cgcgtcgcagaagagtttggctgcgcgctcggccaagaggtcggctacgccgtgctcatc
aagtacatgacggaaggtatgctcatgcgcgagtacctcgccgacgcgacgctctcgcgc
tactcggcgctgatcctcgacgaggcccacgagcgcacgatcaacacggacgtgctcttt
ggtttgctcaaagcactcgtcaagaagcgtccggagctcaagatcatcgtgacgagtgcg
accttggatgcggagaagttttcgcactacttctacgactgcccgatctttacgattccc
ggccgaacgttccccgtcgaaattctgtacacgaaggagccggaagccgactacctcgac
gcggcgctcatcacggtcatgcagatccacctcagcgaaccggaaggcgacattctcgtc
ttcctgacgggccaagaagagattgacacggcgtgcgaggtgctctaccagcgcatcaag
tcgctcggcgccctcgcgcccgagctcatcatcctcccggtctacggtgcgctgccgtcc
gagatgcagacgcgcatctttgagcctgcgcccaaaggctcgcgcaagtgtgtggtcgcg
accaacattgccgaggcgtcgctgacgatcgatggcgtctactacgtcgtggacccgggt
ttccaaaaggagaaggcgttcaacgctaagattggtatggactcgctcatcgtcgtgccg
tgctcgcaagcgtcggcgcggcagcgggccggtcgagccgggcgcacgggccccggcaag
tgctatcgtctctacacggaagcggcgtacaagaacgagatgcttccgaccgcgattccc
gagattcagcgcacgaacctcggcacgatcgtgctgcagctcaaggccatgggcatcaac
gacctcatgggctttgccttcctcgacccgccgcccgtccccgcgctcattgccgccatg
gagaacctctacgcgctcggcgcgctcgacgacgaagggctcttaacgcgcctcggaaag
aagatgtcggagtttcccgtcgagcccaaggacgccaaggtgctcttgacgagcgtcgtg
ctcggctgctcggacgaagtgctcacgatcatctcgatgctcgcggtcgagaatgtcttt
tttcgcccgaaggaaaagcaagcgcaagccgactcgaagaaggccaagttcaaccagccc
gaaggcgaccagctcacgctcctcgcggtgtacgaggcgtggaagcactcgaagttttca
aatccgtggtgttttgagaactttatccaagcccgcgcgatccgccgcgcgttggatgtc
cggaagcagctgctctcgaccatggaccgcttcaagatggacgtggtctcggcgggaaag
aactacaacaagattcggcgcgcgatcgtgtcgggctactttgccaactcggccaagaag
gatccgcaggaagggtaccgcaccatggtggaaggccagcccgtgtacatccacccgtcg
tcgtcgctcttcaataagaacccggagtgggtcatctaccaagaactcgtgctcacgacg
aaggagtacatgcgcaacgtcatggcgatcgaccccaagtggctcaagggcgacccgacc
aagatgaccaagcagaagaaggcgcagaagatcgagccgctccacgaccgcttcaacccc
aaggactcgtggcgtctcagccagcgtcgcggctaa

DBGET integrated database retrieval system