KEGG   Saprolegnia parasitica: SPRG_11111Help
Entry
SPRG_11111        CDS       T04137                                 

Definition
(RefSeq) hypothetical protein
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
spar  Saprolegnia parasitica
Pathway
spar00071  Fatty acid degradation
spar01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:spar00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SPRG_11111
Enzymes [BR:spar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     SPRG_11111
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 24133180
NCBI-ProteinID: XP_012205646
UniProt: A0A067BZG1
Position
Unknown
AA seq 633 aa AA seqDB search
MKVLRPTTPALARAFSSGYVQKTVIPTYHFQKSLMRLPVPKLEDTLNRYLLAVQPVVSPD
EFKATQREVEAFRTGLGPQLHDALVARDKASPETSYINKWWFEMYVRDRQPVAINVNPQI
KIKDDPNPAKNTQNQRAASLIASSVRFFRTLRDKQLEPDVFHTKPQHSKTALFNNVMKML
PEAISFYGAAAVGAYPLDMSQYKNLFQSTRVPGIGEDSLQVFPDSKHIVVQRGSDFFKFD
VLKADGTAVADAEILAQIDAILATPANLTTNGLGLMTTLGRDEWANARAHLIASGTNNAA
SLRDIDSALFMVTLEHAAPESDRDISRTFLTGNGSNHWFDKSFQLLVAANGKASVNFEHS
WGDGVAVLRYLNEMYTDSVKHNPLPVGERSATASPLSFTFSDETKATLAKAHATYEAWTK
RLLIETVETPVTKAIGATHGIGTDGVMQMAIQLAHFRLHGHFVSTYESASTAAFKHGRTE
TIRSCTNEAVAFCTAMENASVSVGDQASALRSAVKKHSELTKNGVMGQGCDRHLFGLRKM
AEIEGLELPGLYTLPSYQTMSHIILSTSTLSSPNLDGGSFGPVNEDCYGIGYGIESIGSM
FQLASYRHDLGDMRDLLAKSVQDIEAVLVATKK
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcctccgcccgacgacgcccgcgctcgcccgcgcctttagctctggctacgtg
cagaagaccgtgatcccgacgtaccacttccagaagtcgctcatgcgcctgcctgtgccc
aagctcgaggacacgctcaaccggtaccttctcgcggtgcagccggtcgtgtcacccgac
gagttcaaggcaacgcagcgcgaggtcgaggccttccgcacgggcctcgggccgcagctc
cacgacgccttggtagcccgcgacaaggcgtcaccggaaacgagctacatcaacaagtgg
tggttcgagatgtacgtgcgtgaccgccagcccgttgcgatcaacgtcaacccgcagatc
aagatcaaggacgacccgaacccggccaagaacacgcagaaccagcgcgcggcgtcgctc
attgcgtcgtcggttcgcttcttccgcacgctgcgcgacaagcagctcgagcctgatgtc
ttccacaccaagccgcagcactcgaagacggcgctctttaacaacgtcatgaagatgctg
cccgaggccatctcgttctacggcgccgccgccgtcggcgcctacccgctcgacatgagc
cagtacaagaacctcttccagtcgacgcgcgtccctggcattggcgaggactcgctccag
gtcttccccgactcgaagcacattgtcgtccagcgcggcagcgatttcttcaagtttgac
gtgctcaaggccgatggcaccgcggtcgcggacgccgagatcctcgcgcagatcgacgcc
atcctggcgacgccggccaacttgacgacgaacggcctgggtcttatgacgacgctcggt
cgtgacgagtgggccaatgcccgcgcccacctgattgcatcgggcaccaacaacgccgcg
agcctccgcgacatcgacagcgcgctcttcatggtgacgctcgagcacgcggcgcccgag
tcggaccgcgatatctcccgcacgttcctcacgggcaacggcagcaaccattggtttgac
aagagcttccagctcttggtggcggccaacggcaaggcgtcggtgaactttgagcactcg
tggggtgacggcgtcgccgtgctccggtaccttaacgagatgtacacggacagcgtgaag
cacaacccgcttccagtgggcgagcggtcggcgacggcctccccgctgtcgttcacgttc
tcggacgaaacgaaagcgacgctggccaaggcccatgcgacgtacgaggcgtggacgaag
cggctgctcatcgagaccgtcgagacgccagtgaccaaggcgattggcgcgacccatggc
attggcacggacggtgtcatgcagatggcgatccagctcgcgcactttcggctgcatggc
cactttgtttcgacgtacgagagcgcgagcacggccgccttcaagcacggccgcaccgag
acgatccggtcatgcacgaacgaggcggtcgccttttgcacggcgatggaaaacgcgtcg
gtctcggtcggcgaccaagcgtcggcgctccggtcggctgtcaagaagcacagtgagctc
acgaagaacggcgtgatgggccagggctgcgaccgccacctctttggtttgcgcaagatg
gccgagatcgagggcctcgagctcccgggcttgtacacgctgccgtcgtaccagacgatg
agccacattatcctctcgacgagcacgctgtcgagccccaacttggacggcggcagcttt
ggcccggtcaacgaggactgctacggcatcggctacggcatcgagtccattggctccatg
ttccagctcgcgagttaccgccacgacctcggcgacatgcgcgacctcctcgccaagagc
gtccaagacattgaggccgtgctcgtggcgaccaagaagtaa

DBGET integrated database retrieval system