KEGG   Saprolegnia parasitica: SPRG_13066Help
Entry
SPRG_13066        CDS       T04137                                 

Definition
(RefSeq) hypothetical protein
  KO
K18081  myotubularin-related protein 1/2 [EC:3.1.3.64 3.1.3.95]
Organism
spar  Saprolegnia parasitica
Pathway
spar00562  Inositol phosphate metabolism
spar01100  Metabolic pathways
spar04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:spar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    SPRG_13066
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    SPRG_13066
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:spar01009]
    SPRG_13066
Enzymes [BR:spar01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     SPRG_13066
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     SPRG_13066
Protein phosphatases and associated proteins [BR:spar01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    SPRG_13066
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related FYVE Y_phosphatase DSPc Y_phosphatase3 GRAM 3-PAP
Motif
Other DBs
NCBI-GeneID: 24134972
NCBI-ProteinID: XP_012209331
UniProt: A0A067C064
Position
Unknown
AA seq 955 aa AA seqDB search
MTSLGKSLQVVIPPVPTDERRTSPERTSTAVGRESPAESIRQVILNEVSRITQKSVAWVP
DSLADKCYQCQANFSLVLRRHHCRRCGNIFCDACSLSRMPLVSAGFFTPVRVCDKCCEAA
KRSHRHMVNERRRQSLTQSLPASSMTTMHADLHHHLPIEDDDDSSLYDVSASQSPMTASL
ADAVCIQTIPGEVVVVRGPDVYLRTPDYKDNEPGTLYITNYRVVFTSLHKPLANEVATPL
RRRSSKTGLGIQSAPMLAPPLYHAIPLRSIDRIKRQELPESDTGVLDLVCKDIRRLQLIF
PGLVQRQTFSFFDKCDQLLRHPMPYFAKVSTETFPTATIGDGWNVYDPVAEFNRLGVGVT
TTWRITSVNYNYSFCPTYSAAIAVPATISDAVLLVAGAFRSKARIPALSWRDVQTGATIC
RSSQPLVGLGQKQCAEDIALIQAIAAANPSSSTLVIVDARPWANAVAQKTVGRAGYELTA
HYEAKPSSDDDEPTVATASMHLGLTDCRLVFMGIENIHIMRKSFQKLVDLCMAKEQRPAT
SGSIGKWNEHVAATKWLDHISCILHAAVEIVRLVKTEKASVLVHCSDGWDRTSQLTALAE
LMLDPHYRTLRGFALLVEKDWCSFGHKFCERTGHPPPSDAINASEVSVVFLQWIECVWQL
MRQFPCSFEFNTRYLILVLDHLYACRFGTFLYDSEMARVHEERSSPTISLWTYLSSLEVS
LISNPFYEPRKYSRQNWHARMKERRQANEVPMPPWTELPPPTFGLEESKDEDLVFVHNDT
TAPARTPMASTSPASPPTDKTTTKTKLVHSIVQDLDTGLMFPHVTEETVVPSRPPRHVRD
ALVASFVSNAADESDESSESSARVSVKSLRLWTEYYLRWDATCSIERNADLEREAKLRDV
LAEMEALQKDDDASSPAWVDVVVEEAVDDDASRFRREMDRMCMAYEDQLSHWLRG
NT seq 2868 nt NT seq  +upstreamnt  +downstreamnt
atgacatcactgggcaagtcgctccaggtagtcatcccgccggtgcccacggacgagcgc
cggacgtcgcctgagcgcacctcgacagcggtcggccgcgagagccccgccgagagcatc
cgccaagtgatcctgaacgaggtgagtcgcatcacgcaaaagtcggtcgcgtgggttccc
gactcgctcgccgacaagtgctaccagtgccaagcgaacttctcgctcgtgctgcgccgc
caccactgtcgccgctgcggcaacatcttttgcgacgcctgctcgctctcgcgcatgcca
ctcgtctcggcgggcttcttcacgcccgtgcgcgtttgcgacaagtgctgcgaggctgcg
aagcggtcccatcggcacatggtcaacgagcggcggcgacagagcttgacgcagagcctg
cctgcgtccagcatgacgaccatgcacgccgacctgcaccatcatctgccgatcgaggac
gacgacgacagcagtctctacgacgtaagtgcgagtcagagcccgatgaccgcgagcctc
gccgacgccgtgtgcattcaaacgattccgggcgaggtcgtcgtcgtgcgcggcccggat
gtctacctgcggacacccgactataaggacaacgagccaggcacgttgtacatcaccaac
taccgcgtcgtctttacgagcctccacaagccgctcgcgaacgaggtcgcgacgccgctg
cgccgccggtcgtccaagacgggcctcggcatccagagcgcgccgatgctggcgccgccg
ctctaccacgcgattcctctgcggtcgatcgaccgcatcaagcgccaagagctgcccgag
tcggacacgggcgtcctcgacctggtgtgtaaggacattcggcgcctccagctcatcttc
cccggcctcgtccagcgccaaacattttcatttttcgacaagtgcgaccagctactgcgg
cacccgatgccgtactttgccaaagtctcgaccgagacgttcccaaccgctacgatcggc
gacggctggaacgtctacgacccggtcgccgagttcaaccggctcggcgtcggcgtcacc
accacgtggcgcatcacgagcgtcaattacaactattcgttttgcccgacgtactcggcg
gccatcgcagtgcccgccaccatctcggacgccgttctcctcgtggccggcgcgttccgg
tccaaggcgcgcatcccagcgctgagctggcgggacgtgcagacaggcgcgaccatctgc
cggagcagccagccgctcgtcgggcttgggcaaaagcagtgtgcggaagacattgcgctc
atccaagcgatcgcggccgccaacccgtcgagcagcacgctcgtcatcgtcgacgcacgc
ccgtgggcgaacgccgtcgcgcaaaagacggtcggacgcgccggctacgagctcacggcg
cactacgaggccaagcccagcagcgacgatgacgagccgaccgtcgcgacggcgtcgatg
cacctcgggctcaccgactgccgacttgtctttatgggcattgaaaacatccatatcatg
cgcaagagcttccagaagctcgtggatttgtgcatggccaaggagcagcggccggccacg
tccggctctatcggcaagtggaacgaacacgtcgcggccaccaagtggctggaccacatt
agctgcatcctccacgccgccgtcgagattgtgcgccttgtcaagacggagaaagcgagc
gtcctcgtgcactgcagcgacggctgggaccgcacgtcgcagctcacggcgctcgccgag
ctcatgctggacccgcactaccgcacgctgcgcgggtttgcgctcctcgtcgagaaggac
tggtgcagcttcggccacaagttctgtgagcgcacgggccacccgccgccgagcgacgcg
atcaacgccagcgaggtctcggtggtctttctccaatggatcgagtgcgtttggcagctc
atgcggcagtttccgtgctcgttcgagttcaacacgcggtacctcatcctcgtgctcgac
catctgtacgcgtgtcgctttggcaccttcctctacgactcggagatggcgcgcgtccac
gaagagcggtcgtcgccgacgatctcgctctggacgtacctctcgtcgctcgaagtctcg
ctcatctccaacccgttctacgagccgcgcaagtactcgcgccaaaactggcacgcgcgc
atgaaggagcgccgccaagcgaacgaggtgccgatgccgccgtggaccgagctgccgcca
ccgaccttcggcctcgaagagagcaaggacgaagaccttgtgtttgtgcacaatgacacg
actgcgccggcgcggacaccgatggcgtcgacgtcgccggcgtcaccgccgaccgacaag
acaacgaccaagaccaagctcgtgcattcgattgtccaggacctcgacacgggcctcatg
tttccccacgtgaccgaggagaccgtcgtgccgtcgcgaccaccgcggcacgtccgagac
gccctggtcgctagctttgtaagcaacgccgccgacgagagcgacgagagcagcgagagc
agcgctcgtgtctcggtcaagtcgctgcggctctggaccgagtactatctgcgctgggac
gcgacttgctcgattgagcgcaacgccgaccttgagcgcgaggccaagctccgggacgtc
cttgcggaaatggaggcgctgcaaaaggacgacgacgcgtcatcgcctgcgtgggtcgat
gtcgtcgtggaagaggccgtcgatgatgacgcgagtcgattccggcgcgagatggaccgc
atgtgcatggcgtacgaagaccagctctcgcactggctgcgcggctaa

DBGET integrated database retrieval system