KEGG   Saprolegnia parasitica: SPRG_14955Help
Entry
SPRG_14955        CDS       T04137                                 

Definition
(RefSeq) CAMK/CAMK1 protein kinase
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
spar  Saprolegnia parasitica
Brite
KEGG Orthology (KO) [BR:spar00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:spar01001]
    SPRG_14955
Enzymes [BR:spar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     SPRG_14955
Protein kinases [BR:spar01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   SPRG_14955
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PH Kdo Kinase-like PH_11 Pkinase_fungal Pox_ser-thr_kin PH_8
Motif
Other DBs
NCBI-GeneID: 24136734
NCBI-ProteinID: XP_012210156
UniProt: A0A067BLP2
Position
Unknown
AA seq 635 aa AA seqDB search
MEEKVLHPQESSASVGGAKKKEEILWSGVLQKRGHLRKNWLTRFFVLTPTHLRYYKKPRS
PNHSSTWNTDKRYLRGELRLTDLIHVESSSADHRPYCFVATFVRQANVLWLYHAHSTIDY
YIQANSDDDRDKWIRLLTSQRGPKFHASVSSSSSMKLAGGSSSSMVCLAPSAPRDIYLYM
VGHCSDDLPGDAVASAKVLAEEFPIFVALIRELDGGDDEHVLVHVLDQMVGEVLDGAWND
TVKKVLALAAEQKLATAPLLWTDAVKTAYMVIMKAMHKQAASSSSRQLKSTFVHGPRLHR
QPSSATFASTYSLGRILGSGAHSVVRVGWHHQQLKQVAVKCIAKAKLLRHEQTSLLQEVA
ILRQLRHPNIVPLLDFVEEDDMYFIVTPLCTGGELFQDLVKRTQYTEDDARNVLLKLASA
VAYIHAQHIMHRDIKPENVLLFSSAPGAEIMLADFGFARMSLGNHLGTACGTPGYIAPEV
VKGTKYGVAVDCWSLGVLLFILLSGQPPFPGHNHADILARVAVGAYSMDAAPWLQVSSAA
KALVRRLLTVDPSQRLTADALLRDPWMRGCSNAATGDDDEGKRDVTQLGSALEEMRLWRA
SGGSSGQLSQACAEDLDDTRGATLLDDELATPVAD
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atggaggagaaagtcttgcacccacaggagagctcggcctcggtgggtggcgccaagaag
aaggaagagatcctctggagcggcgtcctgcagaagcgcggccacttgcgcaagaactgg
ctcacgcgcttcttcgtcctcacgcccacgcacctccggtactacaagaagccacggtcg
ccgaaccatagctcgacgtggaacacggacaagcggtatttacgcggcgagctgcggcta
accgacctcatccacgtcgagagctcgagcgccgaccaccgcccgtactgctttgtcgcg
acctttgtacggcaagccaacgtcctttggctctaccacgcccactcgaccatcgattac
tacattcaggccaactcggacgacgaccgcgacaagtggatccgcctcctcacgtcgcag
cgcggccccaagttccacgcgagcgtctcgtcctcgtcgtcaatgaagctcgcgggcggc
tcgtcgtcctccatggtctgcctcgcgccgtctgctcctcgtgatatctacctctacatg
gtcggccactgcagcgacgatctacccggcgacgcggtcgcctcggccaaggtgctcgcc
gaggagtttccgatctttgtcgcgctcatccgggagcttgatggcggcgacgacgagcac
gtgctcgtccacgtcctcgatcagatggtcggtgaggtcctcgacggcgcgtggaacgac
acggtcaagaaggtgttggcgctcgcggccgagcaaaagctggcgaccgcgccgctgctc
tggacggacgcggtcaagacggcgtacatggtcatcatgaaggccatgcacaagcaagct
gcgtcttcgtcctcgcgacagctcaagtcgacctttgtgcacggaccacgtctccaccgg
cagccgtcgtcggccacgtttgcctcgacgtactcgctcgggcgcatcctgggctcgggc
gcccactcggtggtccgcgtcggctggcaccaccagcagctcaagcaagtcgctgtcaag
tgcatcgccaaggccaagctgctgcggcacgagcagacgtcgctcttgcaagaagtcgcg
atcctccggcagctgcgccaccccaacattgtcccgctcctcgactttgtcgaagaagac
gacatgtacttcatcgtcacgccgctctgcacgggcggcgaactcttccaggacctcgtc
aagcgcacgcagtacacggaagacgacgcgcgcaacgtgctgctcaagctcgcgagcgcc
gtcgcgtacatccacgcccaacacattatgcaccgcgacatcaagcccgagaacgtcctc
ttgttttcgtcggcgccgggcgcggagatcatgcttgccgactttgggttcgcgcgcatg
agcctcggcaaccacctcggcaccgcgtgcggtaccccggggtacattgcgcccgaggtt
gtcaagggcaccaagtacggcgtcgctgtcgactgctggagcctcggcgtgctcctcttc
atcttgctgtctggccagccgccgttcccggggcacaaccacgccgacattctcgcccgc
gtcgccgtcggcgcctactcgatggacgcggcgccgtggttgcaagtatcgagtgccgcc
aaggctctcgtccggcggctgctcacggtcgacccaagccagcgactcacggccgacgct
ctcctccgcgacccgtggatgcgtggctgcagcaacgcggcgactggcgacgacgacgag
ggcaagcgcgacgtgacacagctcggctcggcgctggaggagatgcgtctctggcgcgcc
tcgggcggaagcagcggccagttgagccaggcgtgcgccgaagacctcgacgacacgcgc
ggcgcgacgctcctcgacgatgaactcgccacgcccgtggccgattaa

DBGET integrated database retrieval system