KEGG   Saprolegnia parasitica: SPRG_16070Help
Entry
SPRG_16070        CDS       T04137                                 

Definition
(RefSeq) hypothetical protein
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
spar  Saprolegnia parasitica
Pathway
spar03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:spar00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    SPRG_16070
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:spar03041]
    SPRG_16070
Enzymes [BR:spar01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     SPRG_16070
Spliceosome [BR:spar03041]
 Complex C
  Other components
   Step II factors
    SPRG_16070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Helicase_C HA2 DEAD zf-RING_2 IBR zf-C3HC4 zf-RING_UBOX zf-C3HC4_2 AAA_30 AAA_11 AAA_22 T2SSE AAA_19
Motif
Other DBs
NCBI-GeneID: 24137728
NCBI-ProteinID: XP_012210685
UniProt: A0A067BJJ1
Position
Unknown
AA seq 1697 aa AA seqDB search
MTVHLPARSLGGMAKSASSTEEHKFLQREAKAVADHQRLLHRTRATPDATRDAAVAELES
QLHVFKDIQATFSMATKDDKYRRKRELYRFQQRLPAYAKRDAIERAVTQSRFVVVQGQTG
SGKSTQIPQYLAELFPGTKILVTQPRKLAAMALAERVALEFAGGYEKAATVGGDVGYRVG
GRRQCRTRGRIEFITEGVLLDMIMRQDDELFKGIGAIVVDEAHERSIMCDLLLGSLKSDD
ARWRSIPLVVTSATIDVDLFSTYFGGAPIVDIPGRMFPVDVLYTPTPDGTKDMATYMAQM
ARLLHRDSPQGDILCFLPGQDDVLRAHDVFEKHPEPGLVARTLYGKQDPADQKLAFAHTP
EQRKVLFATDVAETSITIPGVVYVVDSGLKKGVSYDHVRKIASLKVQSIARSSAIQRAGR
AGRTQAGTCVRLYSEHDFELMETSTLPEIFRQPLALAVLTLRRLGIDPKCFEWLSAPPAD
AMAAAERELTFLGALESGRVTALGTTITTLQQPPELVRMLVKSCAQGHGEAALQVAAVQS
VAHMFAWRDKTKKPSTHPMLVSTDGDIVPMVRALAQYRNVLKGVTQVNDTPVRDVVEPSD
ETPVVALTAGHLRRLNGQPRAAIHEHDDDDNDGNTDETRSECSSEASSGDSSESVPTPPK
SATKSNFRTKKIAAQKWCQQNRLNNKALGLAVAFQDELRGQVADLDVWRAQPQTATVSDS
DLRRIVFYGYFLHVACLKRDRSHMLQYCAVEADVVGTIPIEAAIQSGVPPDWIVYDKIFR
PAGRALLVTCTPVDEEWLASESPDFARIVSAKLPALPISTVVLTVPGPVLKKLVGKQLCN
LEALEVQLGCTLHVVPDKGQLLAFCTPAIARGLQPQVDALVAPFQEEMLALTTEQTYLGG
TRAVLGAGFVVNELLFDDEYVTVYVRQLPATMPRRDVRAFVAKAAANCAQPILRALEQQV
VNGGDQSTVAKQVLTRLQGEVIAGRNVQVSAGKAMAKPGLQQSTSSRIKVSWATAASKGV
VKVWFKSASDANRFLLEYRTILPEASRAVAIGASETPAKTPPNGLKPLPPVTRMANKVYL
FNLSTDFTSFLVAVHGLPPAMDEVVLTERLTSMPHERFRIDRVVNSSADQVSSAESVLAV
RARRLGSVLARMPFAFVATDFLDAGRAGVYIVSDDTAALEALYTSALQAWAPAEMPCGQP
IRLALEHTYVARMHVEVFKKRTNLLAPVLTDARRRGVTVFEVPTKTIFQAIRFTCTSRLT
LGRIQAELGEITKCTQFKHADIKRLFSGAGRRFLGELSNDVYVHWNARTGQIFVYGFEDE
FQKAKRAMIGFLEQFAALEVIDHVLMLDKRKIKSLKFASVCARAFDHYVLGAKLYLSGSR
DAILAITTSLQGVLFPKRSGPRTVSTSALECPLCLCDVDATTTQLTLCGHTFCTDCILPM
FGSQDTKLPLRCPRDGCEAALSVEDCVKLVPPSQLEGLAEKAVELYRVQHEDAFSLCPQP
GCNQVFRIAEYKKGKQGEYLAVCDNCEKTYCITCSDKLATPADEHPPVTCQLYQLSANQT
VTGHARRICNEILTLACPKCKAAFLDFSGCTCVTCGNTNCSTNFCANCLVYHDMDSGTCH
NHVRSCPSNPNQGNYFVSAEQLQATHASARKKQTAAYLTRATVAGDERRGVWQMIERDLA
DLGVHFTAQELAQLSIS
NT seq 5094 nt NT seq  +upstreamnt  +downstreamnt
atgacggttcatcttcccgctcggtcgcttgggggcatggcgaagtcggcgtcgtccact
gaagaacacaaatttcttcaacgcgaagccaaggcagtggccgaccatcaacgtctcttg
caccgcacacgtgcgacgccggatgcgactcgagacgccgccgttgcagagctcgagagt
caattgcacgtcttcaaagacatccaagcgaccttctcgatggccacgaaagacgacaag
taccggcgcaagcgcgagctgtaccgcttccagcagcgcttgccggcgtacgccaagcgc
gacgcgatcgagcgcgccgtgacgcagagccgtttcgtggtcgtgcagggccaaacgggc
tcgggcaaaagcacgcaaattccccaatatctcgccgagcttttcccaggtaccaagatc
ctcgtgacacagccacggaagctcgcggccatggccctcgcggagcgcgtggccctcgag
tttgctggcggctacgaaaaggccgcgactgtgggcggcgatgtcggctaccgtgtcggc
ggccggcgccagtgtcgcacgcgtgggcgcatcgagttcatcacggaaggtgtccttctc
gacatgatcatgcgccaagacgacgagctcttcaaaggcattggcgcgattgtggtggac
gaagcacacgagcgcagtatcatgtgcgacttgctgctcgggtcgctcaagtcggacgac
gcgcgctggcgctcgatccctctggtcgtcacgtccgctaccattgacgtcgacctcttc
tcgacgtactttggcggtgcaccgatcgtggacattccggggcgcatgttcccagtcgac
gtcctgtacacgccgacgcccgacggcaccaaagacatggccacctacatggcccagatg
gcgcgactgctccaccgcgacagcccacaaggcgacattctgtgctttctacctggccaa
gacgacgtgttgcgggcccacgacgtgttcgagaagcacccggaaccgggccttgttgcg
cgcactctgtacggcaagcaggacccggcggatcaaaagctcgccttcgcgcataccccc
gagcagcgcaaggtgctcttcgcaacggacgtggccgagacgtcgattacgatccccggg
gtggtctacgtcgtcgacagcgggctcaagaagggcgtgagctacgaccacgtgcggaaa
atcgcgtcgctcaaagtgcagagcatcgcgcggagctcggcgatccagcgggcaggccgc
gccggtcggacgcaagctggcacgtgtgtccggctctacagcgagcacgatttcgagctc
atggagacgagtacgctgcccgagatttttcgacagccgctggcgcttgccgtgctcacg
ctgcgccggctcggcatcgatccaaaatgcttcgagtggctctcggccccgcccgccgac
gccatggcggccgcggagcgcgagctgacgtttcttggcgcgcttgagagcggccgcgtc
acggccctcggtacaacgatcacgacgctgcagcagccgcccgagctcgtgcggatgctt
gtcaagagctgtgcacagggccatggcgaggcagcgctgcaggtcgcggcggttcaatcg
gtcgcgcacatgtttgcgtggcgcgacaagacgaagaagccgtcgacacacccgatgctc
gtctccaccgacggcgatatcgtgccaatggtgcgggcgctggcgcaataccgcaatgtc
ctcaagggcgtcacgcaagtcaacgacacgcccgtgcgagacgtcgtcgagccctcggac
gagacacctgtggttgcgctcacggccgggcatctgcgccggctcaacggacagccgcgc
gccgccatccatgaacatgatgacgacgataacgatgggaacaccgatgagacgcgctcc
gagtgctcgtccgaggcctcgtcaggagacagcagcgagtcggtgccaacgccgcccaag
agcgccaccaagagcaatttccggaccaaaaagatcgccgcgcaaaagtggtgtcaacag
aaccggctcaacaacaaggcactcggccttgctgtcgcgttccaagacgagctgcggggc
caagtcgccgacttggacgtttggagagcgcagccgcaaacggccaccgtgtcggacagc
gacctgcggcgcatcgtcttttacgggtactttttacacgtggcttgtctcaagcgagac
cgcagccacatgctccagtattgcgccgtcgaagccgacgtcgtgggcacgatcccgatc
gaggccgcgatccagagcggggtcccaccagactggatcgtctacgacaagatcttccgc
cccgccggccgcgctctcctcgtgacatgtacgcctgtcgacgaagagtggctcgcctca
gagagcccggatttcgcgcgcatcgtcagcgccaagctgccggcgcttcccatctcgacc
gtcgtgctgaccgtgcccgggcccgtgctcaagaaactcgtggggaagcagctgtgcaac
ctcgaagccctcgaagtccagctcgggtgtacgctgcacgtcgtgccggacaagggtcag
ctactggcgttttgcacgccggccattgcgcgcggtctgcagccgcaggttgatgcgctc
gtcgcaccgttccaggaagaaatgctggcgctcacgacagagcagacgtacctcggcggc
acgcgcgccgttctcggcgctggattcgtcgtcaacgagctgctctttgatgacgagtac
gtcacggtgtatgtgcgccagctccccgccacgatgcctcggcgcgatgtccgagccttt
gttgccaaagccgccgccaactgcgcccagccgattctgcgcgcgctcgagcagcaagtc
gtcaacggcggcgaccaatccaccgtcgccaagcaagtgctcacgcggctgcaaggcgaa
gtcatcgccgggcgcaacgtgcaagtgagcgccggcaaggcgatggccaagcccggcctg
cagcagtcgacatcgagtcgcatcaaagtgtcctgggccaccgctgcctcgaaaggcgtc
gtcaaggtgtggttcaagtcggcgtctgacgccaaccggtttctactcgagtacagaacc
attctgcccgaggcatcgcgcgccgtggcgataggcgcatcggagacgcctgccaagaca
ccaccaaatgggctcaagccactgccacccgtgacgcgcatggccaacaaggtgtacctc
ttcaacctcagcaccgattttacatcgtttcttgtcgccgtacacggtctcccacccgcc
atggacgaggtcgtgctcacggagcgcctcacgtccatgccgcacgagcgcttccgcatc
gatcgcgttgtcaacagctctgcggaccaagtcagctcggcagagagcgtcctcgccgtg
cgggcgcggcggctcggctccgttttggcgcgcatgccatttgcttttgtggccacggat
tttctcgacgctggtcgcgcgggtgtgtacatcgtcagcgatgacacggcggcgctcgag
gctctctacacgtcggcgctccaggcgtgggcaccggcggaaatgccgtgcgggcagcct
atccggcttgccctcgagcacacgtacgtggcgcggatgcacgtcgaagtgttcaagaag
cgcaccaatctgctcgcaccggtgcttacggacgctcggcggcggggtgtcactgtcttt
gaggtgccgacgaaaacgatcttccaagcgatccggttcacgtgcacgtcgcgcctgacc
ctcgggcgaattcaagccgagctcggcgagatcacaaagtgcacgcagtttaagcacgcg
gacatcaagcgtctcttctcgggcgcgggccgccggtttctcggcgagctctccaacgac
gtctacgtgcactggaacgcacgcacgggccaaatcttcgtctacggcttcgaggacgag
ttccagaaggccaagcgcgcgatgatcggattcctcgagcagtttgccgcgctggaggtc
atcgaccatgtgctcatgctggacaagcgcaagatcaagtcgctcaaatttgcatccgtg
tgtgcgcgtgcgtttgatcactacgtcctcggcgccaagttgtacctctcggggtcacgc
gacgccatcctggccattacaacgtccctccaaggcgtcttgttcccaaaacgcagcggg
ccccgcacggtctcgacgagtgcgctcgagtgtccgctgtgcctctgcgacgtggatgca
accacgacgcagttgacgttgtgcggccacaccttttgcaccgactgcatcctgcccatg
tttgggagtcaggatacgaagctgccgctgagatgccctcgggacgggtgcgaggctgcc
ttgagtgtcgaagactgcgtcaagcttgtgccgccgtcgcaactcgagggcttggccgag
aaggccgttgagctctaccgcgtgcagcacgaagacgccttctcgctgtgcccgcagccg
ggttgcaaccaagtgttccgcattgcagagtacaaaaaaggaaagcaaggagaatatctc
gccgtgtgcgacaactgcgagaagacctactgcatcacgtgctcagacaagttggcgacg
cccgccgacgagcacccgcccgtcacctgccagctctatcagctcagcgcgaaccagacg
gtaaccggccacgcccgtcgcatctgcaacgagatcctgacgctcgcttgcccgaaatgc
aaggcggcattcctcgacttctccggctgcacgtgcgtcacgtgcggcaacaccaactgc
agcactaatttctgcgccaactgcctcgtctaccacgacatggacagcggtacctgccac
aaccatgtgcgtagctgtccatcgaatccaaaccaaggcaactactttgtatcggccgag
cagctgcaggcaacacacgccagcgcgcgcaagaagcaaacagccgcgtacctgacgcgt
gccacggtcgccggcgacgaacgacgcggcgtgtggcagatgatcgagcgcgacttggca
gacctcggcgttcacttcactgcgcaggaactcgctcagctatccatttcctaa

DBGET integrated database retrieval system