KEGG   Saprolegnia parasitica: SPRG_17046Help
Entry
SPRG_17046        CDS       T04137                                 

Definition
(RefSeq) hypothetical protein
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
spar  Saprolegnia parasitica
Pathway
spar00670  One carbon pool by folate
spar01100  Metabolic pathways
spar01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:spar00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SPRG_17046
Enzymes [BR:spar01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     SPRG_17046
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-GeneID: 24138611
NCBI-ProteinID: XP_012211749
UniProt: A0A067BLC8
Position
Unknown
AA seq 71 aa AA seqDB search
MKIIDKIRAKLEKDETFYSFEYFPPKTQAGVTNLYSRIDCMAQMDPLFCDMTWGAGGSTD
KLTLEISANVQ
NT seq 215 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcatcgacaagatccgtgccaagctcgagaaggacgagacgttttactcgttc
gagtacttcccgcccaagacgcaggccggcgtgacgaacctctactcgcgcatcgactgc
atggcgcagatggacccgctcttctgcgatatgacgtggggcgccggcggctccacggac
aagctcacgcttgaaatcagcgccaacgtgcaaaa

DBGET integrated database retrieval system