KEGG   Saprolegnia parasitica: SPRG_17648Help
Entry
SPRG_17648        CDS       T04137                                 

Definition
(RefSeq) hypothetical protein
  KO
K06944  uncharacterized protein
Organism
spar  Saprolegnia parasitica
Brite
KEGG Orthology (KO) [BR:spar00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    SPRG_17648
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MMR_HSR1_Xtn MMR_HSR1 TGS FeoB_N Dynamin_N AAA_28 Roc Arf AAA_16
Motif
Other DBs
NCBI-GeneID: 24139180
NCBI-ProteinID: XP_012212418
UniProt: A0A067BFF8
Position
Unknown
AA seq 407 aa AA seqDB search
MGILDKIKEIEDEMKRTQKNKATEGHLGHLKAKLAKLRTELLEGDKSSGGGGEGFDVARS
GDGRVALIGFPSVGKSTLLSQLTDTESETNAVEFTTLTCIPGNLMYNDVRIQLLDLPGII
EGAAHGKGRGREVIAVSKSADMILMVLDAGREEGNRHRAILENELETVGLRLNRNPPDIY
FRKKAGGGISFNATVRLTRMGDDPYKTVYKILHEYRIHNCELLFREDASVDDLIDVIEGN
RKYIKCLYVYNKIDVISIEDVDRLARNPHSVVIACEHNGRPALNFDHLLATMWKYMGLTR
VYTKRRGEQPEFDEPVVLSSERKGTTVNAACMSISKDMLDNFNYALVWGVSTKYNPQRVG
KEHVLLDEDVLQVITKTVNQQKHDKNYNKKVQAHWDKYKAKKKALKT
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggggatcctcgacaagatcaaggagattgaggatgagatgaagcggacgcagaagaac
aaggccacggaaggccaccttggccatctcaaggccaagctcgccaagctgcgcacggag
ctgctcgaaggcgacaagtcgagcggcggcggcggcgaaggttttgacgtggcgaggagt
ggtgacggccgtgtcgcgctcatcgggttcccgtccgtcggcaagtcgacgctcttgagt
cagctcacagacaccgagtccgagacgaacgccgtcgagttcacgacgctaacgtgtatt
cctggcaacctcatgtacaacgacgtgcgcatccagctcctcgatttgcccggtatcatt
gaaggcgctgcgcatggcaagggtcgtggtcgcgaagtcattgctgtctccaagtcggcc
gacatgatcctcatggtgctcgacgctgggcgcgaggagggcaaccgccaccgcgcgatc
ctcgagaacgaactcgagaccgtcggcctgcgcttgaaccggaacccgccggatatttat
ttccgcaagaaggccggcggtggcatttccttcaacgcgactgtgcgcctcacgcgcatg
ggggatgacccgtacaagaccgtctacaagatcttgcacgagtaccggatccacaactgc
gagctcctcttccgcgaagacgcgagcgtcgacgatttgatcgatgtcatcgaaggcaac
cgcaagtacatcaagtgcctctacgtctacaacaagatcgacgtcatctcgatcgaagac
gtcgaccgcctcgcgcgcaacccgcactcggtcgtcattgcctgtgagcacaacggtcgg
cccgcgctcaactttgaccacttgctcgcgaccatgtggaagtacatggggctcacgcgc
gtctacaccaagcgccgtggcgagcaacccgaatttgacgaacccgtcgtcctctcgtcc
gaacgcaagggcacgacggtcaacgccgcgtgcatgtcgatttccaaagacatgctcgac
aacttcaactacgcgctcgtgtggggcgtgagcaccaagtacaacccgcagcgcgtcggg
aaagagcatgtgctcctcgacgaagatgtcctgcaagtcatcaccaagacggtcaaccag
caaaagcacgataagaactacaacaagaaggtccaggcccactgggacaagtacaaggcc
aagaagaaggcgctcaagacctaa

DBGET integrated database retrieval system