KEGG   Saprolegnia parasitica: SPRG_19480Help
Entry
SPRG_19480        CDS       T04137                                 

Definition
(RefSeq) hypothetical protein
  KO
K16675  palmitoyltransferase ZDHHC9/14/18 [EC:2.3.1.225]
Organism
spar  Saprolegnia parasitica
Brite
Enzymes [BR:spar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     SPRG_19480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC PIG-P G0-G1_switch_2
Motif
Other DBs
NCBI-GeneID: 24140839
NCBI-ProteinID: XP_012197407
UniProt: A0A067CNJ8
Position
Unknown
AA seq 307 aa AA seqDB search
MADDDEARLLATTPYYESWHGNQDFYRRGAIVVSKTQWKNCVGTVLFITAVIGLYIYVVM
VTSLPLAYIGVTIPGYINALYWFARTAFMDPGFVPKHYEQQRDAPSTANKDDEPDRFCTF
CEVPKPPRRSHCRVCNCCVDQFDHHCPWTGNCVGKRNHRVFVAFLVALVVLDLFMFGTLV
AFTIQFTFLEDHGLRAFMDRYWIVPVALYATGSTLGLLGAFLAYHLQLISKNMTTNELIR
ARTAQVLAAINATPEENTDNDDDDNRRRRPSAYANWRAHWHRFLTAPTPPSKVLESRATA
APSIVIV
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgacgacgaggcaaggctgctcgcgaccaccccgtactacgagtcgtggcac
ggcaaccaagacttctaccgacgcggcgccatcgtcgtgagcaagacgcagtggaagaac
tgcgtcgggaccgtcctcttcatcacggcggtcatcggtctctacatctacgtcgtgatg
gtcacgtcgctcccgctcgcgtacattggcgtcacgattccaggctacatcaacgcgctc
tactggtttgccaggacggcctttatggaccccggctttgtgcccaagcactacgagcaa
cagcgcgatgcgccgtcgaccgcgaacaaggacgacgagcccgaccggttctgcacgttt
tgcgaagtgcccaagccgccacgccgaagccactgccgcgtctgcaactgctgcgtcgac
cagtttgatcaccactgtccgtggacaggcaactgcgtcgggaagcgcaaccaccgcgtc
ttcgtcgccttcctcgtcgccctcgtcgtcctcgatctatttatgtttggaaccctcgtg
gcctttacgatccaatttacctttctcgaggaccatggcctccgcgccttcatggaccgc
tattggatcgtgcccgtggcgctgtacgcgaccggcagcacgctcggcctcctcggagcg
ttcctcgcctaccatctgcagctcatctcgaaaaacatgacgacgaacgagctcattcgt
gctcggacagcacaggtgctcgcggccatcaacgcaacgcccgaagaaaacaccgacaac
gacgacgacgacaaccgccggcgccggccgtcggcgtacgccaactggcgagcccactgg
caccggttcctcacggcgccgacacctccgagcaaagtcctcgagtcgcgtgcgaccgca
gcgccttccattgtcattgtttaa

DBGET integrated database retrieval system