KEGG   Staphylococcus pasteuri: STP1_0021Help
Entry
STP1_0021         CDS       T02889                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
spas  Staphylococcus pasteuri
Pathway
spas00670  One carbon pool by folate
spas00790  Folate biosynthesis
spas01100  Metabolic pathways
Module
spas_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:spas00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    STP1_0021
   00670 One carbon pool by folate
    STP1_0021
Enzymes [BR:spas01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     STP1_0021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: AGZ24332
Position
complement(21455..21937)
Genome map
AA seq 160 aa AA seqDB search
MTLSILVAHDQQRVIGYQNQLPWHLPNDLKHVKELTTGHTLVMGRKTYESIGKPLPNRRN
VVLTKNMSFHPEGVDVIHSFEEIQQLEGHVFIFGGQTLFEEMIDKVDDMFITVVDGKFQG
DTFFPPYTFEEWEVESSVEGKLDEKSTIPHTFLHLKRKKS
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacattatctattttagtcgcacatgatcaacaaagagttataggttaccaaaatcaa
ttaccatggcacttacctaatgaccttaagcatgttaaagaattaacaacaggtcatacg
ttagtcatgggacgaaaaacttacgaatctattggcaaacctttaccaaatagacggaat
gtggttttgactaaaaatatgtcttttcatcctgaaggtgtggatgtcattcattctttc
gaagagattcaacaattagaaggccacgtatttatttttggtggtcaaacattatttgaa
gaaatgatagataaagtagacgatatgtttattactgtggtagatggaaaatttcaaggt
gatacattctttcctccttacacttttgaagaatgggaagttgagtcatcagttgaaggt
aaactagatgaaaaaagtacaattccacatacatttttacatttaaaaaggaaaaagtca
tag

DBGET integrated database retrieval system