KEGG   Staphylococcus pasteuri: STP1_1114Help
Entry
STP1_1114         CDS       T02889                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
spas  Staphylococcus pasteuri
Pathway
spas00020  Citrate cycle (TCA cycle)
spas00620  Pyruvate metabolism
spas01100  Metabolic pathways
spas01110  Biosynthesis of secondary metabolites
spas01120  Microbial metabolism in diverse environments
spas01200  Carbon metabolism
Module
spas_M00009  Citrate cycle (TCA cycle, Krebs cycle)
spas_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:spas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    STP1_1114
   00620 Pyruvate metabolism
    STP1_1114
Enzymes [BR:spas01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     STP1_1114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Pyr_redox_2 Amino_oxidase K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AGZ25418
Position
complement(1166451..1167950)
Genome map
AA seq 499 aa AA seqDB search
MAKSDKKDVILIGAGVLSTTFGSMLKEIAPDWNIHLYERLDRPGIESSNERNNAGTGHAA
LCELNYTVQQPDGSIDIEKAKEINEQFEISKQFWGHLVKSGNIEDPRAFINPLPHISFVR
GKNNVKFLKDRYEKMKAFPMFDNIEYTEDIEVMRKWIPLMMKGRQNDGGYMAASKIDEGT
DVNYGELTRKMAQHLQETDNVEVKYNHEVVDFTRLSNGKWLVKIKNRNTGDVFEQETDYV
FIGAGGGAIPLLQKTGIPESKHLGGFPISGQFIACTNPEVIKQHDAKVYGKEPPGTPPMT
VPHLDTRYIDGERTLLFGPFANVGPKFLKNGSNLDLFKSVKPYNITTLLASAVKNLPLIK
YSFDQVIMTKEGCMNHLRTFYPEARDEDWQVYTAGKRVQVIKDTEEHGKGYIQFGTEVVN
SQDHSVIALLGESPGASTSVSVALEVLEKNFAEYADEWKPLIKKMIPSYGESLIEDEQLM
RKIRKQTSKDLKLGFYGEK
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagtctgacaaaaaagacgtaattttaattggtgccggtgtacttagtacaact
ttcggatcaatgttaaaagaaattgcgccagactggaatattcatttgtatgaacgctta
gaccgtcctggtattgaaagttctaacgaacgtaacaatgcaggtacaggtcatgctgcg
ctttgtgaattgaactatactgttcaacaacctgatggttcaattgatatcgaaaaagcg
aaagaaatcaacgaacagtttgagatttctaaacaattttggggtcatttagttaaatca
ggaaatattgaagacccacgcgcatttattaatccattacctcatattagttttgtaaga
ggtaaaaataacgttaaattcttaaaagatcgttatgaaaaaatgaaagctttcccaatg
ttcgataatatcgaatacactgaagatatcgaagtaatgagaaagtggattccattaatg
atgaaaggtcgccaaaatgatggtggctacatggcagcaagtaaaattgatgaaggtaca
gatgtaaactacggtgaattaacacgtaagatggcacaacaccttcaagaaactgataat
gtagaagtaaaatacaatcatgaagtggttgattttacacgtttatcaaatggtaaatgg
ttagtcaaaattaaaaaccgtaacacaggtgatgtgtttgaacaagaaacggactatgta
tttattggtgctggtggtggcgcaattccactattacaaaaaacaggtatccctgaaagt
aaacatttaggtggattcccaatcagtggacaattcattgcatgtacaaacccagaagtg
atcaaacaacacgatgccaaagtgtatggtaaagaaccacctggtacaccaccaatgact
gtacctcatttagatacacgttatattgatggtgaaagaacattattattcggaccattt
gcgaacgtaggtcctaaattccttaaaaatggttcaaacttagatttattcaaatctgta
aaaccatacaatattacaactttactagcatctgcagttaaaaacttaccattaatcaaa
tattcattcgaccaagtgattatgactaaagaaggttgtatgaatcatttacgtacattc
tatccagaagcacgtgatgaagattggcaagtttatacagcaggtaaacgtgtacaagtt
attaaagatacagaagaacatggtaaaggttatattcagttcggtactgaagtagtgaat
tcacaagaccactcagtgattgcattattaggtgaatcaccaggggcttcaacttcagta
tctgtagcattagaagttcttgagaaaaacttcgctgaatatgctgatgaatggaaacca
ttaattaagaaaatgattccatcatatggagaatcattaattgaagatgaacaattaatg
agaaaaatccgtaaacaaacttcaaaagaccttaaattaggtttctatggagaaaaataa

DBGET integrated database retrieval system