KEGG   Staphylococcus pasteuri: STP1_1381Help
Entry
STP1_1381         CDS       T02889                                 

Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
spas  Staphylococcus pasteuri
Pathway
spas00230  Purine metabolism
spas00250  Alanine, aspartate and glutamate metabolism
spas01100  Metabolic pathways
Module
spas_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:spas00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    STP1_1381
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    STP1_1381
Enzymes [BR:spas01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     STP1_1381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AGZ25683
Position
complement(1467525..1468808)
Genome map
AA seq 427 aa AA seqDB search
MSSIVVVGTQWGDEGKGKITDFLAEQADVIARFSGGNNAGHTIQFGGETYKLHLVPSGIF
YKDKLAVIGNGVVVDPVALLKELDGLNERGISTDNLRISNRAQVILPYHIAQDEYEERLR
GDNKIGTTKKGIGPAYVDKAQRIGIRMGDLVEKETFERLLKQNIEHKNAYFKGMFNETCP
SFDDMFEKYYAAGQRLREFVTDTPKILDDAIVADEKVLFEGAQGVMLDIDHGTYPFVTSS
NPVAGNVTVGTGVGPTYVSKVIGVCKAYTSRVGDGPFPTELFDEDGHHIREVGREYGTTT
GRPRRVGWFDSVVLRHSRRVSGITDLSINSIDVLTGLDTVKICTAYELDGKEITEYPANL
DQLQRCKPIFEELPGWTEDITGCRTLEELPENARKYLERISELCGVRISIFSVGPDREQT
NLLEKLW
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcaatcgtagtagttgggacacaatggggagacgaaggtaaaggtaaaattaca
gatttcttagcagaacaagcagacgtgattgcacgtttttcaggtggtaataatgcagga
cataccatccaatttggtggagaaacatataaattacatttagtaccatcaggtatcttc
tataaagacaaattagcagttattggtaatggtgtggtagttgatccagttgcattactt
aaagaattagacggtttaaatgaacgtggtatttcaacagataacttacgtatttctaac
cgtgctcaagtgattttaccttatcatattgcacaagacgagtatgaagagcgtcttcgc
ggtgataataaaatcggtacaactaaaaaaggtatcggcccagcatacgtagataaagca
caacgaattggtatccgtatgggagacttagtcgaaaaagaaacattcgaaagactatta
aaacaaaatattgaacataaaaatgcatatttcaaaggtatgtttaatgaaacatgccca
agcttcgatgatatgtttgaaaaatattatgctgcaggtcaacgtttaagagaatttgtt
acagatacacctaaaatcttagacgacgcaattgttgcagatgaaaaagtactattcgaa
ggtgcccaaggtgttatgttagacatcgaccacggtacatatccattcgttacttcaagt
aatccagtagcaggtaacgttactgtaggtacgggtgtaggtccaacatacgtatctaaa
gtaattggtgtatgtaaagcttatacatcacgtgttggtgatggtccattccctacagaa
ttatttgatgaagatggtcatcacattagagaagttggtcgtgaatacggtacaacaact
ggtcgtccacgtcgtgtaggttggttcgactcagtagtattacgtcattcacgccgtgta
agtggtattacagacttatcaatcaactcaattgatgtgttaactggcttagatacagtt
aaaatctgtacagcatatgaattagatggtaaagaaattactgaatatccagctaaccta
gatcaattacaacgttgtaaaccaatcttcgaagagttaccaggttggacggaagatatt
acaggttgtcgtactttagaagaacttcctgaaaatgcacgcaaatatttagaacgtatt
tctgaattatgtggcgtacgcatttcaatcttctcagtaggtccagatcgtgaacaaaca
aatttattagaaaaattatggtaa

DBGET integrated database retrieval system