KEGG   Staphylococcus pasteuri: STP1_1386Help
Entry
STP1_1386         CDS       T02889                                 

Definition
(GenBank) putative homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
spas  Staphylococcus pasteuri
Pathway
spas00270  Cysteine and methionine metabolism
spas00920  Sulfur metabolism
spas01100  Metabolic pathways
spas01110  Biosynthesis of secondary metabolites
spas01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:spas00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    STP1_1386
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    STP1_1386
Enzymes [BR:spas01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     STP1_1386
    2.3.1.46  homoserine O-succinyltransferase
     STP1_1386
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Collar
Motif
Other DBs
NCBI-ProteinID: AGZ25688
Position
complement(1474027..1474992)
Genome map
AA seq 321 aa AA seqDB search
MSNYTVDTLELGQFTTESGETIRNLKLTYEHVGYPGQPLALVCHALTGNHLTYGTDEHPG
WWREIIDGGYMPINDYQFLTFNVIGSPFGSSSKHNDPHFPDHLTLRDIVRALEKGIEALG
FNKIDILIGGSLGGMQALELLYNRRFQVDKAVILAATDKTSSYSCAFNEIARQAIHIGGK
EGLSIARQLGFLTYRSSKSYDQRFTPEEVVSYQQHQGNKFKESFDLSCYLTLLDVLDSHN
IDRGRDDVDEVFKSLDTKVLTMGFIDDLLYPDDQVLAVGQRFKYHRHFFVPDNVGHDGFL
LNFEDWAPNLYHFLNAKHIRR
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaattatacagttgatacattagaattaggccaatttacgacagagtctggagaa
acgatacgaaacttaaaattaacatatgaacatgtaggttatcctggacaaccattagca
ttagtttgccatgcattaactggtaatcatcttacatatggtacagatgaacatccaggt
tggtggcgtgaaattattgatggtggttatatgcctatcaatgattatcaatttttaaca
ttcaacgtgatagggagtccatttggttccagttcaaagcataatgatccacattttcca
gatcatttaacattaagagatatcgtacgcgcactggagaaggggatagaagcactagga
tttaataaaatagatattttaatcggtggtagtttaggtggtatgcaagcactagaatta
ctttataatcgacgattccaagtagataaagcggttatacttgctgctacagataaaacc
tcatcgtacagttgtgcctttaacgaaattgctagacaagcgattcatatcggaggtaaa
gaaggtttaagtattgcccgacaattaggatttttaacctatcgatcttctaaaagttat
gatcaacgcttcacacctgaagaggtagttagttatcaacaacatcaagggaacaagttc
aaagaatcctttgatttatcatgttatttaaccctgctggacgtcttagatagtcataat
attgatagaggcagagatgatgttgatgaggtgtttaaatcattagacacaaaggtatta
acgatgggattcatagatgatttgttatatccagatgatcaagtgttagcggtaggacaa
cgctttaaatatcatcgacacttttttgtaccagataacgtgggacacgatggtttctta
ctaaattttgaagattgggcacccaatttatatcactttttaaatgcgaaacatattcga
cgataa

DBGET integrated database retrieval system