KEGG   Staphylococcus pasteuri: STP1_1419Help
Entry
STP1_1419         CDS       T02889                                 

Definition
(GenBank) putative L-iditol 2-dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
spas  Staphylococcus pasteuri
Pathway
spas00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:spas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    STP1_1419
Enzymes [BR:spas01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     STP1_1419
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     STP1_1419
    1.1.1.-  
     STP1_1419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc 2-Hacid_dh_C Pyr_redox AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AGZ25720
Position
1509478..1510515
Genome map
AA seq 345 aa AA seqDB search
MKAAVWYGQKDVRVEEREPKELQDNEVKVKVSWAGICGTDLHEYLEGPIFISTEKPDPFL
GQKAPVTLGHEFAGVVEETGSQVTKFNKGDRVVVNPTVSKREKEENIDLYDGYSFIGLGS
DGGFAEFTNAPEENVYKLPDNVSDKEGALVEPTAVAVQAIKEGEVLFGDTVAIFGAGPIG
LLTVVAAKAAGASKIFVFDLSEERLSKAKALGATHAINSGKSDPVDVVNKYTENGVDVSF
EVAGVAPTLKSSIDVTKARGTVVIVSIFGHPIEWHPMQLTNTGVKLTSTIAYTPTTFQQT
IDLINEGNLNVKDVVTDEIELENIVESGFEQLVNDKSQAKILVKL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcagtttggtatggtcaaaaagatgtaagagttgaagaacgtgaacctaaa
gaattacaggacaatgaagttaaggttaaagtatcttgggcaggcatttgtggtacagat
ttacatgaatacttagaaggccctatatttatttcaacagaaaagccagatccattctta
ggccaaaaagcgccagttacattgggtcatgaatttgcaggtgtagtagaagaaactggt
tcccaagttacaaaatttaataaaggcgatcgagttgtagttaaccctacagtttcaaaa
cgtgaaaaagaagaaaatattgacctttatgatggttattcatttataggcttaggttct
gatggtggatttgcagagtttacaaatgcgccggaagaaaatgtttataaactaccagat
aatgtttctgataaagaaggtgcacttgtcgaaccaacagccgttgctgttcaagcaatt
aaagaaggtgaagttctatttggtgatactgtagctatttttggtgcaggaccaattgga
ttattaacagtcgtagcagccaaagcagctggtgcaagtaaaatatttgttttcgattta
tcagaagaaagactaagtaaagctaaagcactaggcgcgactcatgctataaactctggt
aagtcagatccagttgatgttgttaataagtacacagaaaatggtgtagatgtatctttt
gaagtggctggtgtagcaccaacactaaaatcttctatagatgttacaaaagcgagaggt
acagttgttatcgtttctatttttggacatcctatcgagtggcatccaatgcaattaact
aatacaggagtaaaacttacttctacaattgcatacacacctactacattccaacaaaca
attgacttaatcaacgaaggtaatttaaacgttaaagatgtagttactgatgaaattgag
ttagaaaatatcgtagaatcaggatttgaacaacttgtaaatgataaatctcaagcaaaa
attttagttaaattataa

DBGET integrated database retrieval system