KEGG   Staphylococcus pasteuri: STP1_1451Help
Entry
STP1_1451         CDS       T02889                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
spas  Staphylococcus pasteuri
Pathway
spas00071  Fatty acid degradation
spas00072  Synthesis and degradation of ketone bodies
spas00280  Valine, leucine and isoleucine degradation
spas00310  Lysine degradation
spas00362  Benzoate degradation
spas00380  Tryptophan metabolism
spas00620  Pyruvate metabolism
spas00630  Glyoxylate and dicarboxylate metabolism
spas00640  Propanoate metabolism
spas00650  Butanoate metabolism
spas00900  Terpenoid backbone biosynthesis
spas01100  Metabolic pathways
spas01110  Biosynthesis of secondary metabolites
spas01120  Microbial metabolism in diverse environments
spas01130  Biosynthesis of antibiotics
spas01200  Carbon metabolism
spas01212  Fatty acid metabolism
spas02020  Two-component system
Brite
KEGG Orthology (KO) [BR:spas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    STP1_1451
   00630 Glyoxylate and dicarboxylate metabolism
    STP1_1451
   00640 Propanoate metabolism
    STP1_1451
   00650 Butanoate metabolism
    STP1_1451
  09103 Lipid metabolism
   00071 Fatty acid degradation
    STP1_1451
   00072 Synthesis and degradation of ketone bodies
    STP1_1451
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    STP1_1451
   00310 Lysine degradation
    STP1_1451
   00380 Tryptophan metabolism
    STP1_1451
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    STP1_1451
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    STP1_1451
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    STP1_1451
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spas04147]
    STP1_1451
Enzymes [BR:spas01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     STP1_1451
Exosome [BR:spas04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   STP1_1451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Dodecin ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AGZ25750
Position
1540103..1541287
Genome map
AA seq 394 aa AA seqDB search
MSRIVLAEAYRTPIGVFGGAFKDIPAYDLGATLIKHILKTTQIDPNEINEVILGNVLQAG
QGQNPARIAAIKGGLPESVPAFTVNKVCGSGLKSIQLAYQSILAGDNDVVLAGGMESMSQ
SPMLMKNARFGFKMGNQALVDSMVADGLTDVFNDYHMGITAENLVEKYSISREAQDEFAA
QSQQKAEAAQNSGAFDAEIVPVEVPQRKGEPIVVSEDEGIRKGTTADKLSHLRPAFKKDG
SVTAGNASGINDGASMMLVMTEEKAKELNIKPIAILDGFGTSGVDPSIMGIGPVDAVKKA
LQRTNQSIEDIDVFELNEAFASQALAVNQELQLPAEKVNTKGGAIALGHPIGASGARILV
TLLHQLNEEKQSGIASLCIGGGQGIATAVTRYQE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgtatcgtattagctgaagcatatcgtacaccaattggcgtgtttggaggtgct
tttaaagatattcctgcctatgatttaggtgccactttaattaaacacattttaaagaca
actcaaattgatccaaatgaaattaatgaagtgatattaggtaacgttttacaagcaggt
caaggacaaaatccagctcgcatagcagcaattaagggcggtttacctgaatccgttcca
gcgtttacagtaaataaagtttgtggttcagggttaaaatctattcaattagcatatcaa
tccattttagcaggggacaatgatgtcgtattagcaggcggtatggaaagtatgtcccaa
tcaccgatgcttatgaaaaatgcacgattcgggtttaaaatgggtaaccaagcgttagtt
gatagtatggtagcagatggattaacagacgtatttaatgattatcatatgggcattacg
gctgaaaacttagttgaaaaatatagtattagccgtgaagcgcaagatgaatttgctgca
caatcacaacaaaaagcagaagccgctcaaaatagtggtgcttttgatgcggaaatcgtt
ccagtcgaggtaccacaacgtaaaggcgagcctattgtcgtatcagaagacgaaggcatt
agaaaaggtacaacagctgataaattgagtcacttgagacctgcctttaaaaaggacgga
tcagtaacagctggtaatgcgtcaggtattaatgacggtgcatcaatgatgttagtaatg
actgaagaaaaggcaaaagaattaaatattaaacctatcgctattttagacggctttggt
actagcggtgtggatccttctattatgggaattggtccagttgacgcagtgaaaaaagca
ctacaacgtacaaaccaatctattgaagatatcgatgttttcgaacttaatgaagcattt
gcatcacaggctttagcagtaaatcaagaattacaattacctgctgaaaaggttaatact
aaaggtggtgccattgctttaggtcatcctataggtgcctcaggtgcacgtatattagtg
acacttttacatcaattaaacgaagaaaagcaatcaggtattgcatcattatgtattggt
ggcggacaaggtattgcgacagcggtgacacgttatcaagagtaa

DBGET integrated database retrieval system