KEGG   Staphylococcus pasteuri: STP1_1571Help
Entry
STP1_1571         CDS       T02889                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
spas  Staphylococcus pasteuri
Pathway
spas00450  Selenocompound metabolism
spas00970  Aminoacyl-tRNA biosynthesis
spas01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spas00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    STP1_1571
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    STP1_1571
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spas01007]
    STP1_1571
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:spas03016]
    STP1_1571
Enzymes [BR:spas01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     STP1_1571
Amino acid related enzymes [BR:spas01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   STP1_1571
Transfer RNA biogenesis [BR:spas03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    STP1_1571
 Prokaryotic type
   Other AARSs
    STP1_1571
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f tRNA-synt_1d ARL2_Bind_BART PilM tRNA-synt_1c T4_neck-protein
Motif
Other DBs
NCBI-ProteinID: AGZ25869
Position
1675544..1677514
Genome map
AA seq 656 aa AA seqDB search
MAKDTFYITTPIYYPSGNLHIGHAYSTVAGDVIARYKRMQGYDVRYLTGTDEHGQKIQEK
AQKAGKTELEYLDEMIAGIKSLWDKLEISNDDFIRTTEERHKQVVEKVFERLLKQGDIYL
GEYEGWYSVPDETYYTESQLVEPVYENGKIVGGKSPDSGHEVELVKEESYFFNIKKYTDR
LLEFYDQNPDFIQPPSRKNEMINNFIKPGLEDLAVSRTSFNWGVSVPSNPKHVVYVWIDA
LVNYISSLGYLSDDETLFNKYWPADIHLMAKEIVRFHSIIWPILLMALDLPLPKKVFAHG
WILMKDGKMSKSKGNVVDPNVLIDRYGLDATRYYLMRELPFGSDGVFTPEAFVERTNYDL
ANDLGNLVNRTISMINKYFQGELPAYQGPKHELDEDMEAMALDTVKEFHENMESLQFSVA
LSTVWKFISRTNKYIDETTPWVLAKDESQKDMLGNVMAHLVENIRFATVLLRPFITHAPK
EIFKQLNINNPELMEFSSLETYGALTEPITVIAKPTPIFPRLDTEAEIAYIKESMQPPKS
EEKEDIPSKDIIDIKDFDKVEIKAATVIDAENVKKSDKLLKIQVDLDNEQRQIVSGIAKF
YRPEDIIGKKVAVVTNLKPAKLMGQKSEGMILSAEKDGVLTLISLPNAIPNGAIIK
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagatacattttatataacaaccccaatttattatccaagtggtaacttgcat
attgggcatgcatactcaactgtagcaggtgatgtgattgctagatataaacgaatgcaa
ggatatgacgttcgttatttaacaggaacagatgagcatggtcaaaaaattcaagaaaaa
gcacaaaaagctggtaaaactgaattagaatatttagatgagatgattgctggaattaaa
agtttatgggataaattagaaatctcaaatgatgatttcattcgaactactgaagaacga
cataagcaagtcgttgaaaaagtattcgaacgtttattaaaacaaggtgacatttacctt
ggtgagtatgagggatggtattctgtaccagacgaaacatattacacagagtcacaatta
gttgaacctgtttatgaaaatggcaagattgttggagggaaaagtcctgattcaggccat
gaagtagaattagtaaaagaagaaagttatttctttaatattaaaaaatatactgatcgt
ttacttgaattctatgatcaaaatcctgactttattcaaccgccttcaagaaaaaatgaa
atgattaataactttattaaaccaggtttagaagatttagctgtttcacgtacgtcattt
aactggggcgttagtgtgccttcaaatcctaaacatgttgtttatgtatggatagacgcg
ttagtaaattatatttcttctctaggttatttatcagatgacgaaacgttatttaacaaa
tattggccagcagatatccacttgatggccaaagaaatcgtacgattccattcaattatt
tggccaattttattaatggcattagatttaccattacctaagaaagtctttgcacatggt
tggatactaatgaaagacggtaaaatgagtaaatcaaaaggcaatgttgttgaccctaat
gtattaattgatcgttatggcttagatgctacgcgttattatttaatgcgagaattacca
tttggttcagacggtgtgtttacaccagaagcgtttgttgaacgtactaactatgattta
gctaatgatttaggtaacttagtaaatcgtaccatttcaatgattaataaatatttccaa
ggtgaacttcctgcatatcaaggtcctaaacatgaattagacgaagacatggaagctatg
gcgctagatacagttaaagagttccatgaaaatatggagagtttacaattctctgtagct
ttatcaacagtttggaaatttattagccgtactaataaatatattgatgagacgacacca
tgggttttagcgaaagatgaaagtcaaaaagatatgttgggcaatgtgatggcacatctt
gttgaaaacatccgctttgcaactgtattattacgaccatttattacacatgcaccaaaa
gaaatatttaaacaattaaatattaataatccagagttaatggaattctcaagtttagag
acttatggtgccttaacagaacctatcactgtaatagctaaaccaacaccaatattccct
agattggatactgaagcggaaattgcttatattaaagaatcaatgcaaccaccaaaatct
gaggaaaaagaagatattccaagtaaagacatcattgatattaaagactttgataaagtg
gaaattaaagctgcaacagtgattgatgctgaaaatgttaagaaatcagataaactatta
aaaattcaagtggatttagacaatgaacaacgacaaattgtttctggtattgcgaaattc
tatcgtcctgaagatatcattggtaaaaaagttgctgtagtaactaacttaaaacctgcg
aaattaatgggacaaaaatctgaaggtatgattttatcagcagaaaaagatggtgtgtta
acattgattagcttgccaaatgctattccaaatggcgcaatcattaagtaa

DBGET integrated database retrieval system