KEGG   Streptococcus pantholopis: A0O21_02715Help
Entry
A0O21_02715       CDS       T05054                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
spat  Streptococcus pantholopis
Pathway
spat00480  Glutathione metabolism
spat00590  Arachidonic acid metabolism
spat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spat00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    A0O21_02715
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A0O21_02715
Enzymes [BR:spat01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     A0O21_02715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin DUF743
Motif
Other DBs
NCBI-ProteinID: AND79008
UniProt: A0A172Q6B8
Position
complement(559990..560466)
Genome map
AA seq 158 aa AA seqDB search
MANLYDFTVKAQNEEEVSLREYQDSVVLVVNTATGCGLTPQYEGLQQLYDTYRTQGFTIL
DFPCNQFKGQAPGTAEEINAFCTLNYQTSFPRFAKVDVNGKNAIKLYDWLKSEKKGPLGQ
KIEWNFAKFLIDRQGNVVKRFSSKTDPRKIAPAIEKLL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatctttatgactttacagttaaagctcaaaatgaggaagaggtttccctaagg
gaatatcaggattcagttgtattagtagttaacactgcaacaggctgcggcctgactccc
cagtatgaaggacttcagcagctctatgatacttaccggacgcaaggcttcactatcctt
gattttccctgcaatcagtttaaaggccaagcaccaggaacagctgaggaaatcaatgcc
ttttgcaccttgaattatcagacaagcttcccacgttttgctaaagtcgatgttaacggc
aaaaatgctattaaactttatgattggctgaaatctgaaaaaaaagggccattaggccaa
aaaattgaatggaatttcgctaaatttttaattgaccggcaaggcaatgttgtcaagaga
ttttcatctaaaacagatccccgtaagattgctcctgctattgaaaaattgctgtaa

DBGET integrated database retrieval system