KEGG   Streptococcus pantholopis: A0O21_10100Help
Entry
A0O21_10100       CDS       T05054                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
spat  Streptococcus pantholopis
Pathway
spat03010  Ribosome
Brite
KEGG Orthology (KO) [BR:spat00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    A0O21_10100
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:spat03011]
    A0O21_10100
Ribosome [BR:spat03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    A0O21_10100
  Bacteria
    A0O21_10100
  Archaea
    A0O21_10100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AND80305
UniProt: A0A172QA81
Position
2169175..2169519
Genome map
AA seq 114 aa AA seqDB search
MAEITSAKAMARTVRVSPRKTRLVLDLIRGKNVADAIAILKFTPNKAARVVEKTLNSAIA
NAENNFGLEKADLVVSETFANEGPTMKRFRPRAKGSASPINKRTTHVTVVVAEK
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaattacttcagctaaagcaatggctcgtacagtgcgtgtttcgcctcggaaa
acacgtcttgtgcttgatcttattcgagggaaaaatgttgctgacgcaattgcaatttta
aagtttacacctaataaagccgctcgtgtggttgaaaaaacccttaattcagccatcgcc
aatgcagaaaacaactttggtttagagaaggctgatttagtggtatctgaaacattcgct
aatgagggaccgacgatgaaacgtttccgtccccgtgcgaaagggtcggcttcgccgatt
aacaaacggacaactcacgttactgtagttgtagcagaaaaataa

DBGET integrated database retrieval system