KEGG   Sphingomonas paucimobilis: DRN02_001940Help
Entry
DRN02_001940      CDS       T06034                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
spau  Sphingomonas paucimobilis
Pathway
spau00480  Glutathione metabolism
spau00590  Arachidonic acid metabolism
spau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spau00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    DRN02_001940
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DRN02_001940
Enzymes [BR:spau01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     DRN02_001940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: QBE90925
UniProt: A0A411LF07
Position
424428..424907
Genome map
AA seq 159 aa AA seqDB search
MSDIGKFTVTAADGRAVDMSAYAGRVLLIVNTASQCGFTPQYEGLEALHRRYEAQGLTVL
GFPCNQFGGQEPGDATEIANFCSTTYDVTFPVLAKVEVNGDGADPLFQWLKAEAPGLLGT
KRIKWNFTKFLVNRDGEVVGRYAPTTKPEDLSKDIEAVL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatcggcaaattcaccgtcacggcggcggatggccgggccgtcgacatgtcc
gcctatgccggccgcgtgctcttgatcgtcaacacggcgtcccaatgcggcttcacccca
caatatgaagggctggaggcgctgcatcgtcgttatgaggcgcaggggctgacggtgctg
ggatttccctgcaaccagtttggtgggcaggagccgggcgatgcgaccgagatcgcgaat
ttctgttcgacgacctatgacgtgaccttccccgtgctcgccaaggtggaagtcaatggt
gacggggccgatccgctgttccagtggctgaaggcggaggcgcctgggctgttggggacg
aagaggatcaagtggaacttcacgaagttcctggtcaaccgcgatggtgaggttgtgggc
cgctatgccccgacaaccaaacccgaagatttgtcaaaggatatcgaggccgttctgtaa

DBGET integrated database retrieval system