KEGG   Sphingomonas paucimobilis: DRN02_007160Help
Entry
DRN02_007160      CDS       T06034                                 

Gene name
mqo
Definition
(GenBank) malate dehydrogenase (quinone)
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
spau  Sphingomonas paucimobilis
Pathway
spau00020  Citrate cycle (TCA cycle)
spau00620  Pyruvate metabolism
spau01100  Metabolic pathways
spau01110  Biosynthesis of secondary metabolites
spau01120  Microbial metabolism in diverse environments
spau01130  Biosynthesis of antibiotics
spau01200  Carbon metabolism
Module
spau_M00009  Citrate cycle (TCA cycle, Krebs cycle)
spau_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:spau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DRN02_007160 (mqo)
   00620 Pyruvate metabolism
    DRN02_007160 (mqo)
Enzymes [BR:spau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     DRN02_007160 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO K_oxygenase FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: QBE91821
UniProt: A0A411LHT3
Position
complement(1511162..1512886)
Genome map
AA seq 574 aa AA seqDB search
MRSDDRNQRGRARAPEPVGQDGITRRAMMGSALAAGTASVAPFVAEAAASEQKVDVLLIG
GGIMSATLGVLLRELEPGWTIEMVERLDKVAEESSNGWNNAGTGHSALCELNYTPVNEAD
GRVEIKKAIEINEQFQVTRQFLSHQLRTGVLQNPRSFINSTPHMNLVWGDENVAFLQKRH
AALLASPLFSGMEFTTDPRQIAQWVPLMIEGRKGGQKLAATRSQLGTDCEWGEVTRQYIR
SMQGKPGVTLTTGHEVRSLERNNDGTWRVTARDMKTGDKRIITARFVFAGAGGGALPILQ
KSGIPEGDDYAGFPVGGSFLVTENPAIARRHLAKVYGKAATGSPPMSVPHLDTRYLNGKQ
VLLFGPFATFSTKFLKEGSYFDLPKSVTLDNFRPMLSVGWNEFELVEYLAGQLMMSQEDR
MNALREYFPNAKDGDWRLWQAGQRVQIIKRDPDKGGVLKLGTEIVASKDGSIAALLGASP
GASTAPSIMLNLIKKVFPDRLATPAWQAKIREIVPSYGTALNEDRDLLAHEWAATAETLQ
LAMAPPAVSSPATTEAPRPEATRVSPNRHPDLAL
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgcgaagtgacgatcgaaaccagcggggccgggcgcgtgctcccgaacctgttggccag
gacgggatcacccggcgggccatgatgggttccgcgctggcggcgggcacggcttcggtc
gcgccgttcgtggcggaggcggcggcgtccgagcagaaggtcgacgtgctgctgatcggc
ggcggcatcatgagcgcgacgctgggtgtgctgctgcgcgaactggagcccggctggacg
atcgagatggtcgagcggctggacaaggtggcggaggaaagctccaacggctggaacaat
gccggcaccggccattcggcgctgtgcgaacttaactatacgccggtcaacgaggccgac
gggcgggttgagatcaagaaggcgatcgagatcaacgagcagttccaggtcacgcgccag
ttcctaagtcaccagctccgcaccggggtgctgcagaacccccgcagcttcatcaactcg
accccgcacatgaacttggtgtggggcgacgagaatgtcgccttcctgcagaagcgccac
gccgcgctgctcgccagcccgctcttctccggcatggagttcaccaccgacccgcgccag
atcgcgcaatgggtgccgctgatgatcgaagggcgcaagggcgggcagaagctcgccgcg
acccggtcccagctcggcactgattgcgaatggggcgaggtgacgcgccaatatatccgc
tcgatgcagggcaagcccggcgtgacgctgaccaccggtcacgaggtccgctcgctggag
cgcaacaatgacggcacgtggcgcgtgaccgcgcgcgacatgaagacgggcgacaagcgg
atcatcaccgcacgcttcgtcttcgccggggcgggcggtggtgcgctgcccatcctgcag
aaatcgggtatccccgaaggcgacgattatgccggcttccccgtcggcggatcgttcttg
gtgaccgagaatcccgccatcgcgcgccgtcatctggccaaggtctatggcaaggccgcg
accggatcgccgcccatgtcggtaccgcatctcgacacccgttatctgaacggcaagcag
gtgctgttgttcgggccctttgcgaccttctcgaccaagttcctgaaggaaggttcctac
ttcgatctgcccaagtcggtgacgctcgacaatttccggccgatgctgtcggtcggctgg
aacgagttcgagctggtcgaatatctggcgggccagttgatgatgagccaggaagaccgg
atgaacgcgctccgggaatatttcccgaatgccaaggacggcgattggcggctatggcag
gcgggccagcgcgtgcagatcatcaagcgcgatcccgataagggcggcgtcctgaagctc
ggtaccgagatcgtcgcgtcgaaggacgggtcgatcgccgcgttgctgggcgcctcgccc
ggcgcctcgaccgcgccgtcgatcatgctgaacctgatcaagaaggtcttccccgaccgg
ctggcgacccccgcctggcaggcgaagatccgcgagatcgtgccgagctatggcaccgcg
ctcaatgaggatcgcgatctgctggcgcatgaatgggcggcgacggcggagaccttgcaa
ctcgccatggccccgccggccgtgtcgagccctgcgaccaccgaggccccgcgccccgag
gcaacgcgggtcagccccaaccgccatcccgatctggcgctgtaa

DBGET integrated database retrieval system