KEGG   Sphingomonas paucimobilis: DRN02_010045Help
Entry
DRN02_010045      CDS       T06034                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
spau  Sphingomonas paucimobilis
Pathway
spau00071  Fatty acid degradation
spau00072  Synthesis and degradation of ketone bodies
spau00280  Valine, leucine and isoleucine degradation
spau00310  Lysine degradation
spau00362  Benzoate degradation
spau00380  Tryptophan metabolism
spau00620  Pyruvate metabolism
spau00630  Glyoxylate and dicarboxylate metabolism
spau00640  Propanoate metabolism
spau00650  Butanoate metabolism
spau00900  Terpenoid backbone biosynthesis
spau01100  Metabolic pathways
spau01110  Biosynthesis of secondary metabolites
spau01120  Microbial metabolism in diverse environments
spau01130  Biosynthesis of antibiotics
spau01200  Carbon metabolism
spau01212  Fatty acid metabolism
spau02020  Two-component system
Brite
KEGG Orthology (KO) [BR:spau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DRN02_010045
   00630 Glyoxylate and dicarboxylate metabolism
    DRN02_010045
   00640 Propanoate metabolism
    DRN02_010045
   00650 Butanoate metabolism
    DRN02_010045
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DRN02_010045
   00072 Synthesis and degradation of ketone bodies
    DRN02_010045
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DRN02_010045
   00310 Lysine degradation
    DRN02_010045
   00380 Tryptophan metabolism
    DRN02_010045
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DRN02_010045
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DRN02_010045
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DRN02_010045
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spau04147]
    DRN02_010045
Enzymes [BR:spau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DRN02_010045
Exosome [BR:spau04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DRN02_010045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C DUF3948
Motif
Other DBs
NCBI-ProteinID: QBE92325
UniProt: A0A411LIZ4
Position
2126720..2127892
Genome map
AA seq 390 aa AA seqDB search
MTEIVITAAKRTPVGSFLGAFAATPAHELGRVAITAALEQAGIKGEDVSEVILGQVLTAA
QGQNPARQASMAAGIPKEVPAYGVNQVCGSGLRAVALGMQAIANGDATIVVAGGQESMSL
SPHAQTMRGGTKMGPLTMVDTMVHDGLTDAFNGYHMGITAENLAEQYQVTRDEQDQFAVR
SQNLAEKARGEGRFKDEIAPVTIKGRKGETIIADDEYIRAGATLEAVSGVRPAFKKDGTV
TAANASGLNDGAAALVLMSREEADKRGATVLATIKSWASAGVDPSVMGIGPVPATKRALE
KAGWTVGDLDLIEANEAFAAQALSVGKELGFDPDKVNVNGGAIALGHPIGASGARVLTTL
IYEMQKRDAKKGLATLCIGGGMGIAMCVER
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagatcgtcattaccgccgccaagcgcacccccgtaggcagcttcctgggcgcc
tttgccgctacgcccgcgcatgagctgggccgggtggcgatcaccgccgcactggaacag
gcgggcatcaagggcgaggacgtgtccgaggtcattctcggccaggtgctgaccgccgcg
caaggccagaacccggcacgccaggcgtcgatggcggcgggcatcccaaaggaagtgcct
gcctacggcgtcaaccaggtctgcggttcggggctccgcgccgtggcgctcggcatgcag
gcgatcgccaatggcgacgcgaccatcgtcgtcgcgggcggccaggaatccatgtcgctg
tcgccccatgcgcagacgatgcgcggcggcaccaaaatgggcccgctgaccatggtcgac
accatggtccatgacggcctgaccgacgccttcaacggctatcacatgggcatcaccgcc
gagaatctggccgagcagtatcaggtgacccgcgacgagcaggatcagttcgccgtccgc
tcgcagaacctggccgaaaaggcgcgcggcgagggccgcttcaaggacgagatcgctccc
gtcaccatcaagggccgcaagggcgaaaccatcatcgccgatgacgaatatatccgcgcc
ggcgcgaccctcgaagccgtgtcgggcgttcgccccgccttcaagaaggacggcaccgtc
accgccgccaacgcctcgggcctcaacgacggcgccgccgcgcttgtgctgatgagccgc
gaggaagccgacaagcgcggcgcgaccgtgctggcgacgatcaagagctgggcctcggcg
ggcgtcgacccgtcggtgatgggaatcggccccgtccccgccaccaagcgcgcgctcgaa
aaggcgggctggaccgtcggcgacctcgacctgatcgaagcaaacgaggcgttcgcggct
caggccctgtcggtgggcaaggaactgggcttcgaccccgacaaggtcaacgtcaacggc
ggcgcgatcgcgctcggccacccgatcggcgccagcggtgcgcgggtgctgacgactctg
atctacgaaatgcagaagcgcgacgcgaagaaggggctggccactttgtgcatcggcggc
ggcatgggaatcgccatgtgtgttgagcgataa

DBGET integrated database retrieval system