KEGG   Streptomyces parvulus: Spa2297_07565Help
Entry
Spa2297_07565     CDS       T04685                                 

Definition
(GenBank) NAD-dependent dehydratase
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
spav  Streptomyces parvulus
Pathway
spav00053  Ascorbate and aldarate metabolism
spav01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    Spa2297_07565
Enzymes [BR:spav01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     Spa2297_07565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase 3Beta_HSD GDP_Man_Dehyd NAD_binding_10 Polysacc_synt_2 NAD_binding_4 NmrA RmlD_sub_bind KR adh_short
Motif
Other DBs
NCBI-ProteinID: ANJ06867
UniProt: A0A191UW11
Position
1633543..1634352
Genome map
AA seq 269 aa AA seqDB search
MPASRTVLLTGAAGGLGTLMRDLLPAHGHELRLLDLRPVEGEPDAIVADLADRDALREAV
RGIDAILHLAGISLEAPFEKILKANIEGTYNLYEAAREAGVRRVVFASSNHAVGYTPRPV
GDDPLIPVETPRRPDTFYGLSKCFGEDLAQLYWDKHGIETVSVRIGSCFPAPTSVRMLSV
WMSPADGARLFHAALTAEDVGHTVVHGSSSNTRLWWDLGSARALGYEPRDDSEPYAGKLL
AEQGPLEPGNPAHAYLGGPFVTDPPIWPY
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcttcccgcaccgtcctgctcaccggcgccgccggcggcctcggcaccctgatg
cgggacctcctccccgcccacggccatgaactgcgcctgctcgacctgcgccccgtcgag
ggcgagccggacgcgatcgtcgccgacctcgcggaccgggacgcgctgcgcgaggcggtc
cgcgggatcgacgcgatcctccacctcgcgggcatctccctggaagcccccttcgagaag
atcctcaaggcgaacatcgagggcacgtacaacctgtacgaggcggcccgcgaggcaggc
gtccgccgcgtcgtcttcgcctcctccaaccacgccgtcggctacacgccgcggccggtg
ggcgacgaccccctcatcccggtggagacgccgcgccgcccggacaccttctacggcctg
tccaagtgcttcggcgaggacctggcccagctctactgggacaagcacggcatcgagacc
gtctccgtccggatcggctcctgcttccccgcgcccaccagcgtgcgcatgctctcggtg
tggatgagcccggccgacggcgcccggctcttccacgccgccctcaccgccgaggacgtc
ggacacaccgtcgtccacggctcctcgtccaacacccgcctgtggtgggacctcggctcc
gcgcgggcgctcggctacgagccgcgggacgactccgagccgtacgccgggaaactcctc
gccgagcagggcccgctggagccgggcaaccccgcccacgcgtacctgggcggccccttc
gtgaccgaccccccgatctggccgtactga

DBGET integrated database retrieval system