KEGG   Streptomyces parvulus: Spa2297_29070Help
Entry
Spa2297_29070     CDS       T04685                                 

Definition
(GenBank) ergothioneine biosynthesis protein EgtC
  KO
K07008  gamma-glutamyl hercynylcysteine S-oxide hydrolase [EC:3.5.1.118]
Organism
spav  Streptomyces parvulus
Pathway
spav00340  Histidine metabolism
spav01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spav00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Spa2297_29070
Enzymes [BR:spav01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.118  gamma-glutamyl hercynylcysteine S-oxide hydrolase
     Spa2297_29070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_6 GATase_4
Motif
Other DBs
NCBI-ProteinID: ANJ10676
UniProt: A0A191V6N0
Position
complement(6476706..6477503)
Genome map
AA seq 265 aa AA seqDB search
MCRHLAYLGPSEPLGRLLVAPPHGLYRQSWAPRRQRHGTVNADGFGVGWYAGDDPVPARY
RRAGPIWADQSFADLARVVRSGAFLAAVRDATLAGADAEAAAAPFAAGARLFSHNGAVTG
WPGSLAGPAGTLPPEELLSLEARNDSALVWALVLARLRAGDDDGRALAETVLEVAAAAPG
SRLNLLLTDGATVTATTWGDTLWYLTLPGGGTVVASEPYDDDPRWREVPDRTLLVADRAE
VRLTPLKEPGDTATQAFVSPKEPRT
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtgccgccacctcgcgtacctcggcccgtccgagccgctcggccggctcctggtcgcg
ccgccgcacggcctgtaccgccagtcgtgggcgccccgccgccagcggcacggcacggtc
aacgccgacgggttcggcgtcggctggtacgccggggacgacccggtgccggcccgctac
cgccgggccgggccgatctgggcggaccagtccttcgccgacctcgcccgggtggtgcgg
tccggcgcgttcctcgccgccgtacgggacgcgacgctcgcgggcgccgacgcggaggcc
gcggccgctcccttcgcggcgggcgcccggctgttcagccacaacggagccgtgaccggc
tggcccggctccctggccgggccagccgggacgctgccgcccgaagagctgctttcgctg
gaggcccgcaacgactcggccctcgtgtgggcgctggtgctggcccggctgcgggccggg
gacgacgacgggcgggcgctggccgagacggtgctggaggtcgccgcggcggcccccggc
tcgcgcctcaacctgctgctcaccgacggcgccaccgtcacggcgaccacctggggcgac
accctctggtacctgacccttcccggcggcggcaccgtcgtcgcctcggagccctacgac
gacgacccgcgctggcgggaggtccccgaccgcaccctgctcgtggccgaccgcgccgag
gtgcggctcaccccgctgaaggaaccgggcgacaccgccacgcaagccttcgtctctccc
aaggagccccgcacgtga

DBGET integrated database retrieval system