KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy1268
Entry
M28_Spy1268       CDS       T00263                                 
Symbol
ssb2.1
Name
(GenBank) phage single-strand DNA binding protein
  KO
K03111  single-strand DNA-binding protein
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
Pathway
spb03030  DNA replication
spb03430  Mismatch repair
spb03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:spb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    M28_Spy1268 (ssb2.1)
   03430 Mismatch repair
    M28_Spy1268 (ssb2.1)
   03440 Homologous recombination
    M28_Spy1268 (ssb2.1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spb03032]
    M28_Spy1268 (ssb2.1)
   03400 DNA repair and recombination proteins [BR:spb03400]
    M28_Spy1268 (ssb2.1)
   03029 Mitochondrial biogenesis [BR:spb03029]
    M28_Spy1268 (ssb2.1)
DNA replication proteins [BR:spb03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    M28_Spy1268 (ssb2.1)
DNA repair and recombination proteins [BR:spb03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     M28_Spy1268 (ssb2.1)
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    M28_Spy1268 (ssb2.1)
Mitochondrial biogenesis [BR:spb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    M28_Spy1268 (ssb2.1)
SSDB
Motif
Pfam: SSB tRNA_anti-codon Phage_SSB tRNA_anti_2
Other DBs
NCBI-ProteinID: AAX72378
UniProt: Q48SD2
Position
complement(1260447..1260866)
AA seq 139 aa
MINNVVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAEN
LANWAKKGALIGVTGRIQTRNYENQQGQRVYVTEVVADNFQMLESRNQQSGQGNSSQNDN
SQPFGNSNPMDISDDDLPF
NT seq 420 nt   +upstreamnt  +downstreamnt
atgattaataatgtagtactagttggtcgcatgaccaaggacgcagagcttcgctataca
gcgagtcaagtagctgtagctacgttcacacttgcggtaaaccgcagatttaaagagcaa
aacggggagagagaagcagatttcattaactgtgttatctggcgacagtctgctgaaaat
ttagccaactgggctaaaaaaggtgctttgatcggagttacgggtcgtattcagacacgt
aactacgaaaaccaacaaggacaacgtgtctatgtaacagaagttgttgcagataatttc
caaatgttggaaagtcgtaatcaacaatctggtcaaggtaactcttcgcaaaacgataac
agtcaaccgtttggcaattcaaacccaatggatatttcagacgatgatctgccgttttaa

DBGET integrated database retrieval system