KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy1280
Entry
M28_Spy1280       CDS       T00263                                 
Name
(GenBank) phage antirepressor protein
  KO
K07741  anti-repressor protein
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
Brite
KEGG Orthology (KO) [BR:spb00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    M28_Spy1280
SSDB
Motif
Pfam: ANT AntA Peptidase_C3 Bro-N
Other DBs
NCBI-ProteinID: AAX72390
UniProt: Q48SC0
Position
complement(1264879..1265607)
AA seq 242 aa
MNNLITVTLNENQEPIVSGRDLHQALEIKTQYTKWLERMSDYGFEENEDYVAISQKRLTA
QGNQTEYTDHVLKLDMAKEIAMLQRNEKSKQVRKYFIQIEKDFNSPEKIMARALLMADKK
VHKLEAQIEADRPKVLFADAVSASKSSCLIGELAKILKQNGVNIGQNKLFQWLRANGYLI
SRRGESWNQPTQKSMQLGLFELKKTAINHSDGHTTTNVTPKVTGKGQQYFINKFFNQEYL
PV
NT seq 729 nt   +upstreamnt  +downstreamnt
atgaataatcttatcacagtaacactaaacgaaaaccaagaacctattgtttctggtcga
gatttgcatcaagcattagaaattaaaactcagtacacaaaatggttagaacgaatgtct
gattatgggtttgaagaaaatgaagactatgtagctattagtcaaaaaagactaacagct
cagggcaatcaaacagaatatacagaccacgttctaaaactagacatggctaaagaaatt
gcgatgcttcaacggaacgaaaagtctaaacaagtccgcaaatactttatccaaatcgaa
aaagacttcaacagccctgagaaaatcatggcaagggcgttgctgatggcggataagaaa
gtgcataaacttgaagcacaaatcgaggcagaccgtcccaaagtactatttgctgatgct
gtaagtgctagcaaatcatcttgtctgattggtgagttagctaaaatcctgaaacagaat
ggagtcaatattggtcagaataagctatttcagtggttacgagccaacggctacctaatc
agtcgccgtggtgagtcttggaatcagccaacgcaaaaaagtatgcagcttggattgttt
gaactcaaaaaaacagccatcaatcactctgacggtcacactacaacaaatgtaacccca
aaagttactggtaaagggcaacaatactttattaataaattctttaaccaggaatatctg
ccagtttag

DBGET integrated database retrieval system