KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy0420Help
Entry
M28_Spy0420       CDS       T00263                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
Pathway
spb00071  Fatty acid degradation
spb00072  Synthesis and degradation of ketone bodies
spb00280  Valine, leucine and isoleucine degradation
spb00310  Lysine degradation
spb00362  Benzoate degradation
spb00380  Tryptophan metabolism
spb00620  Pyruvate metabolism
spb00630  Glyoxylate and dicarboxylate metabolism
spb00640  Propanoate metabolism
spb00650  Butanoate metabolism
spb00900  Terpenoid backbone biosynthesis
spb01100  Metabolic pathways
spb01110  Biosynthesis of secondary metabolites
spb01120  Microbial metabolism in diverse environments
spb01130  Biosynthesis of antibiotics
spb01200  Carbon metabolism
spb01212  Fatty acid metabolism
spb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:spb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    M28_Spy0420
   00630 Glyoxylate and dicarboxylate metabolism
    M28_Spy0420
   00640 Propanoate metabolism
    M28_Spy0420
   00650 Butanoate metabolism
    M28_Spy0420
  Lipid metabolism
   00071 Fatty acid degradation
    M28_Spy0420
   00072 Synthesis and degradation of ketone bodies
    M28_Spy0420
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    M28_Spy0420
   00310 Lysine degradation
    M28_Spy0420
   00380 Tryptophan metabolism
    M28_Spy0420
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    M28_Spy0420
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    M28_Spy0420
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    M28_Spy0420
Enzymes [BR:spb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     M28_Spy0420
Exosome [BR:spb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   M28_Spy0420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AAX71534
UniProt: Q48US2
Position
427308..428456
Genome map
AA seq 382 aa AA seqDB search
MTDVYIAAGLRTPIGLVGKQFAKEQPEILGAKLINALQNKYPVPIDQVICGNAVGTGGNI
GRLMTLYSHLGESVSALTVDMQCASAGAALSVGYAKIKAGMASNLLVGGIESSSLQPESV
YASADWRQGAYKVAQFSPDSISPFAMIEGAERVAREHGFTKEYLNHWTLRSHQKASYCQE
QALLADLILDLPGASDQGIRPRLSSKVLSKVPPILGEDHVISAANACLTHDAAAFLQLSS
QPSAFKLIDVVEVAGDPQRSPLMVIKASQVLLEKHGLGMADMTAIEWNEAFAVIDGLFET
HYPDLLDRYNIFGGALAYGHPYGASAAIIILHLMRALEIKNGRYGIAAIAAAGGQGFAVL
LKYHKEFSHADKARILGKAMPK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgacggatgtttatattgctgcaggccttagaacccctatcggtttagtagggaaacaa
tttgctaaagaacaaccagaaatccttggagcaaagctcatcaatgctttacaaaataag
tatccagttcccattgaccaagtgatttgtggcaatgccgtcggaacgggtggtaatatt
gggcgcctgatgaccctgtattctcatttaggagaatctgtctctgctttgacggttgat
atgcagtgtgcatcagctggtgcagctctttccgtgggttatgctaaaatcaaggcaggt
atggcaagcaaccttttagtgggagggattgaaagcagctccttacaacctgaatcggta
tatgcttcagctgattggcgccaaggagcctacaaggtagctcagttttctccagatagt
atcagcccttttgcgatgattgaaggggcagaacgagtggcaagagagcatggctttaca
aaggagtatttgaatcactggacattgagaagtcatcaaaaggctagttattgccaggag
caagccctgttagctgatcttattctagacctgccaggagccagtgatcaaggtattcga
ccgcgcttgtcaagtaaggtgttgtcaaaggtaccccctatcttaggagaagatcacgtg
attagtgcagccaatgcctgcctaacccatgatgctgctgcctttttacagctaagtagt
cagccttcagcttttaaactgattgatgtggtagaagtagcaggagacccacagcgtagc
cctttaatggtgattaaggctagtcaagtccttttggaaaaacatggtctagggatggca
gatatgacagcgattgaatggaacgaagcctttgccgttattgatggtctatttgaaacc
cattatccagatttattggaccgctataatatatttggtggtgcattagcttatggtcat
ccctatggtgcctcagcagccattataatattgcacttaatgagggctttagagattaaa
aatggacgctatggaatagctgctatagcagcagctggtggccaagggtttgctgtttta
ctaaaatatcataaggagtttagtcatgctgacaaagctagaatattgggcaaagcaatg
cccaaataa

DBGET integrated database retrieval system