KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy0666Help
Entry
M28_Spy0666       CDS       T00263                                 

Definition
(GenBank) 3-hydroxy-3-methylglutaryl-coenzyme A reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
Pathway
spb00900  Terpenoid backbone biosynthesis
spb01110  Biosynthesis of secondary metabolites
spb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:spb00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    M28_Spy0666
Enzymes [BR:spb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     M28_Spy0666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red CAMSAP_CH
Motif
Other DBs
NCBI-ProteinID: AAX71779
UniProt: Q48U27
Position
complement(686879..688156)
Genome map
AA seq 425 aa AA seqDB search
MTKTNLNWSGFSKKTFEERLQLIEKFKLLNAENLNQLKTDVLLPIQTANQMTENVLGRLA
LPFSIAPDFLVNGSTYQMPFVTEEPSVVAAASFAAKLIKRSGGFKAQTLNRQMIGQIVLY
DIDQIDNAKAAILHKTKKLIALANKAYPSIVKRGGGARTIHLEEKGEFLIFYLTVDTQEA
MGANMVNTMMEALVPDLTRLSKGHCLMAILSNYATESLVTTSCEIPVRLLDHDKTKSLQL
AQKIELASRLAQVDPYRATTHNKGIFNGIDAVVIATGNDWRAIEAGAHAYASRNGSYQGL
SQWHFDQDKQVLLGQMTLPMPIASKGGSIGLNPTVSIAHDLLNQPDAKTLAQLIASVGLA
QNFAALKALTSSGIQTGHMKLHAKSLALLAGATQDEIAPLVNALLADKPINLEKAHFYLS
QLRQS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaactaatcttaactggagcggtttttcaaagaaaacattcgaagaacgcctc
caacttatcgaaaaatttaaactacttaatgctgaaaacttaaatcaactcaaaacagac
gttcttttgcctatccaaacagctaatcaaatgactgaaaatgtcttaggacgattggct
ttgccctttagcatagctcctgattttcttgtcaacggttcaacttatcagatgcctttt
gtcacggaagaaccttctgttgttgctgcagcatctttcgcagcaaaactaatcaaacgc
tcaggtggttttaaagctcaaaccctaaaccgacaaatgattggtcaaattgttctttac
gatatcgaccaaatagataacgctaaagccgccatccttcataaaacaaaaaagctaatt
gcattggcaaataaagcttatccttccattgttaaaagaggtggaggcgctagaaccatt
catttggaagaaaaaggagagtttttgattttctatctgactgttgatacccaagaagct
atgggagcaaatatggtcaatactatgatggaagctcttgttcctgatttaacaagactg
tctaaggggcattgtctaatggcgattttatctaattacgcaacagagtcgcttgttact
actagttgtgagattcccgtgcgccttttagatcacgataaaacaaaatccctacagtta
gctcaaaaaatagagctagccagccgactagctcaagtagatccttaccgggctactact
cataataaaggtatttttaatggcattgatgcagtggtaatagccacaggaaatgactgg
cgtgctattgaagcaggggcccatgcttatgcctcaagaaatggtagctatcaaggactt
agtcagtggcattttgaccaagataaacaagttctgcttggccaaatgaccctccctatg
cctattgctagtaaggggggatctatcgggcttaaccctactgtttctatcgcacatgat
cttcttaatcaacctgatgccaaaacattagcccaattgattgcatctgtggggttagct
caaaactttgctgcactaaaagctctgacctcatctggcatccaaactggtcacatgaaa
ctacatgcgaaatcattagctcttttggcgggggcaacccaagacgaaattgctccttta
gttaatgctttactagctgataaaccaataaatctagaaaaagcacatttttacttatcc
cagctaagacagtcttag

DBGET integrated database retrieval system